DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and achi

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001286352.1 Gene:achi / 36373 FlyBaseID:FBgn0033749 Length:555 Species:Drosophila melanogaster


Alignment Length:227 Identity:56/227 - (24%)
Similarity:81/227 - (35%) Gaps:32/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RMLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICNWFANWRRK-LKNSEREKAKKSWGHLIKN 104
            ::||.||...|.|.|||..||..|:.|..||..|:||||.|.||: |....|.:........|..
  Fly   106 KILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRRILPEMIRREGNDPLHFTISR 170

  Fly   105 YNHNARGNVEQFSISSEDSIWEEEMHSCPAEDDEGDDNEEFSSHSTGSDGNANNEPSSPYKPILF 169
            .......|..:.|....:.......|..||.:......||........:|.||         :| 
  Fly   171 RGKKVSPNCSRSSALGANLTGPNPAHGSPASEVVVGATEEVDGAGEIHEGIAN---------VL- 225

  Fly   170 VGSAGLTERISAQTGGKTKYKHQMMEKYMRDSSTAKTTSQQGTQLNKWLESAAKFTP-DR-NNYH 232
               ....:.:....|...|.:.:..:..:.....|...:..|.|.   |.|:.:.|. |: .||.
  Fly   226 ---TNFEQYVQGPNGQMVKMEPEYEDSVIYSWQQAIANNPMGFQS---LHSSLQATMIDKIKNYQ 284

  Fly   233 IEWNMTRQKASSNSSCGQAIFTTDVSGAGRGG 264
            :      :||:       ||..:.|...|.||
  Fly   285 M------RKAA-------AIGGSAVGSGGAGG 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 19/37 (51%)
achiNP_001286352.1 Homeobox_KN 111..150 CDD:283551 20/38 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.