DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and irx3b

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_998265.1 Gene:irx3b / 321806 ZFINID:ZDB-GENE-030131-525 Length:343 Species:Danio rerio


Alignment Length:286 Identity:70/286 - (24%)
Similarity:110/286 - (38%) Gaps:92/286 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LKDWLIRRRENPYPSREEKKQLAAETGLTYTQICNWFANWRRKLKNSEREKAKKSW--------- 98
            ||.||...|:||||::.||..||..|.:|.||:..||||.||:||    ::.|.:|         
Zfish   116 LKAWLSEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLK----KENKMTWVPKTRTDED 176

  Fly    99 GHLIKNYNHNA--RGNVEQFSISSEDSIWEEEMHSCPAEDDE-----GDDNEEFSSHSTGSDGNA 156
            |::..:.|.:|  |...|:..:.:.|:...|:...|..:||:     |.|:||:      .|..|
Zfish   177 GNVYTSDNEDAEKRDEDEEIDLENIDTEDIEDKQDCDYQDDDKSTPKGSDSEEY------DDARA 235

  Fly   157 -----------------NNEPSSPYKPILFVGSAGLTERISAQTGGKTKYKHQMMEKYMRDSSTA 204
                             ..|||:...|.|                 |.|.           .|.|
Zfish   236 EKRIIEDEEQIKKSPAEEQEPSNNISPAL-----------------KPKI-----------WSLA 272

  Fly   205 KTTSQQGTQLNKWLESAAKFTPDRNNYHIEWNMTRQKASSNSSCGQAIFTTDVSGAGRGGRWMLH 269
            :|.:...:....|::........||..|:: |.|:...|::    |..||:...|        |.
Zfish   273 ETATTPDSPKKTWIQRNCDAQTVRNPLHVQ-NWTKMALSAH----QMAFTSHYLG--------LK 324

  Fly   270 HKDELEAAEALANL-AFNCRQRWHHI 294
            |       :::.|: ..:..||.|.:
Zfish   325 H-------QSITNIHVKHAEQRTHSL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 19/37 (51%)
irx3bNP_998265.1 Homeobox_KN 119..158 CDD:283551 20/38 (53%)
ASF1_hist_chap <174..255 CDD:304562 16/86 (19%)
IRO 261..278 CDD:214716 7/44 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.