DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and Tgif1

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001015020.1 Gene:Tgif1 / 316742 RGDID:1310517 Length:287 Species:Rattus norvegicus


Alignment Length:154 Identity:41/154 - (26%)
Similarity:60/154 - (38%) Gaps:56/154 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKSTRPKRNRRHSRRAWPPEEELHPASRATKRLFTPDIKRMLKDWLIRRRENPYPSREEKKQLA 65
            :|.|:.....:|. ||...|:|.:                ::|:|||...|.|.|||.:||..|:
  Rat    40 LDLSSSAASGKRR-RRGNLPKESV----------------QILRDWLYEHRYNAYPSEQEKALLS 87

  Fly    66 AETGLTYTQICNWFANWRRKL----------------------KNSEREKAKKSWGHLIKNYNHN 108
            .:|.|:..|:||||.|.||:|                      |.||....:.:.|  |||:   
  Rat    88 QQTHLSTLQVCNWFINARRRLLPDMLRKDGKDPNQFTISRRGAKISEASSIEAAMG--IKNF--- 147

  Fly   109 ARGNVEQFSISSEDSIWEEEMHSC 132
                        ..::.|...|||
  Rat   148 ------------MPTLEESPFHSC 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 18/37 (49%)
Tgif1NP_001015020.1 Homeobox_KN 68..107 CDD:283551 19/38 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.