powered by:
Protein Alignment CG11617 and Meis2
DIOPT Version :9
Sequence 1: | NP_001245817.1 |
Gene: | CG11617 / 33183 |
FlyBaseID: | FBgn0031232 |
Length: | 294 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_038960864.1 |
Gene: | Meis2 / 311311 |
RGDID: | 1305198 |
Length: | 496 |
Species: | Rattus norvegicus |
Alignment Length: | 59 |
Identity: | 27/59 - (45%) |
Similarity: | 38/59 - (64%) |
Gaps: | 1/59 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 RATKRLFTPDI-KRMLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICNWFANWRRKL 86
|..||...|.: ..:::.||.:...:||||.|:|||||.:||||..|:.|||.|.||::
Rat 295 RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRI 353
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0773 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.