DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and Meis2

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_038960864.1 Gene:Meis2 / 311311 RGDID:1305198 Length:496 Species:Rattus norvegicus


Alignment Length:59 Identity:27/59 - (45%)
Similarity:38/59 - (64%) Gaps:1/59 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 RATKRLFTPDI-KRMLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICNWFANWRRKL 86
            |..||...|.: ..:::.||.:...:||||.|:|||||.:||||..|:.|||.|.||::
  Rat   295 RQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRI 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 21/37 (57%)
Meis2XP_038960864.1 Meis_PKNOX_N 129..213 CDD:406806
Homeobox_KN 313..352 CDD:399131 22/38 (58%)
PAT1 <354..>482 CDD:401645 27/59 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.