DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and Irx1

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001100801.1 Gene:Irx1 / 306659 RGDID:1309060 Length:480 Species:Rattus norvegicus


Alignment Length:148 Identity:47/148 - (31%)
Similarity:68/148 - (45%) Gaps:17/148 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 HSRRAWPPEEELHPASRATKRLFTPDIKRMLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICN 77
            |:..|:.|..:.........:..|.:....||.||...|:||||::.||..||..|.:|.||:..
  Rat   112 HTTPAYYPYGQFQYGDPGRPKNATRESTSTLKAWLNEHRKNPYPTKGEKIMLAIITKMTLTQVST 176

  Fly    78 WFANWRRKLKNSEREKAKKSWGHLIKNYNHNARGNVEQFSISSEDSIWEEEMHSCPAEDDEGDDN 142
            ||||.||:||    ::.|.:||...|:.        |..::...|:..:.|    .|||||..|.
  Rat   177 WFANARRRLK----KENKVTWGARSKDQ--------EDGALFGSDTEGDPE----KAEDDEEIDL 225

  Fly   143 EEFSSHSTGS-DGNANNE 159
            |......... ||:.:||
  Rat   226 ESIDIDQIDERDGDQSNE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 19/37 (51%)
Irx1NP_001100801.1 Homeobox_KN 145..184 CDD:283551 20/38 (53%)
SDA1 <194..>252 CDD:283052 16/62 (26%)
IRO 309..326 CDD:214716
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.