DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and Irx4

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001100800.1 Gene:Irx4 / 306655 RGDID:1309309 Length:515 Species:Rattus norvegicus


Alignment Length:275 Identity:70/275 - (25%)
Similarity:101/275 - (36%) Gaps:61/275 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 TPDIKRMLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICNWFANWRRKLKNSE------REKA 94
            |.:....||.||...|:||||::.||..||..|.:|.||:..||||.||:||...      |.|.
  Rat   151 TRETTSTLKAWLQEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWPPRNKC 215

  Fly    95 ---KKSWGHLIKNYNHNARGNVEQFSISSEDSIWEEEMHSCPAEDDEGDDNEEFSSHSTGSDGNA 156
               |:.:|          .|..|:   :.|:...||.:.|..:|...|.:::|............
  Rat   216 ADEKRPYG----------EGEEEE---AGEEESREEPLKSVKSEGPAGKEDKELELSDLEDFDPL 267

  Fly   157 NNEPS-----SPYKPILFVGSAGLTERISAQTGGKTKYKHQMMEKYMRDSSTAKTTSQQGTQLNK 216
            :.|.|     :|::|:     ..:.|||...:.|....|...:...| ...||     .|..::.
  Rat   268 DTETSECELKTPFQPL-----DSVPERIPPSSDGPGTGKEAPVTLRM-PLGTA-----DGAVMDG 321

  Fly   217 WLESAAK------FTPDRNNYHIEWNMTRQKASSNSSCGQAIFTTDVSGA-----GRGGRWMLHH 270
            .||.|..      ..||..            |.......:|..|...:||     .:...|.|.|
  Rat   322 DLERARNCLRSTVVAPDSG------------AEGGPQACEAKLTFAPAGAPPNLETKPRIWSLAH 374

  Fly   271 KDELEAAEALANLAF 285
            .....||.||:...|
  Rat   375 TATAAAATALSQTEF 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 19/37 (51%)
Irx4NP_001100800.1 Homeobox_KN 161..200 CDD:283551 20/38 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.