DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and Pknox1

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001013092.1 Gene:Pknox1 / 294322 RGDID:1305003 Length:436 Species:Rattus norvegicus


Alignment Length:163 Identity:45/163 - (27%)
Similarity:68/163 - (41%) Gaps:42/163 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LH--PASRATKRLFTP-DIKRMLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICNWFANWRRK 85
            ||  ..|...||...| ....:::.||.:...:|||:.:||||:||:|.||..|:.|||.|.||:
  Rat   252 LHQEDGSSKNKRGVLPKHATNVMRSWLFQHIGHPYPTEDEKKQIAAQTNLTLLQVNNWFINARRR 316

  Fly    86 LKN-------SEREKAKKS----------W-------------GHL------IKNYNHNARGNVE 114
            :..       ||..|.||.          |             |.|      :.........||:
  Rat   317 ILQPMLDSSCSETPKTKKKPAQNRPVQRFWPDSLASGVAQATPGELAMSEGAVVTITTPVNMNVD 381

  Fly   115 QF-SISSEDSIW--EEEMHSCPAEDDEGDDNEE 144
            .. |:||:.:..  ::.|.:..:||:..|..|:
  Rat   382 SLQSLSSDGATLAVQQVMMAGQSEDESVDSTED 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 19/37 (51%)
Pknox1NP_001013092.1 Meis_PKNOX_N 80..165 CDD:406806
Homeobox_KN 277..316 CDD:399131 20/38 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.