DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and Mkx

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_008770033.2 Gene:Mkx / 291228 RGDID:1305652 Length:356 Species:Rattus norvegicus


Alignment Length:300 Identity:91/300 - (30%)
Similarity:127/300 - (42%) Gaps:64/300 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RPKRNRRHSRRAWPPEEELHPASRATKRLFTPDIKRMLKDWLIRRRENPYPSREEKKQLAAETGL 70
            ||....||.|:|                  ..|:.|.||.||.:.|:||||::.||..||..:.:
  Rat    65 RPGGKVRHKRQA------------------LQDMARPLKQWLYKHRDNPYPTKTEKILLALGSQM 111

  Fly    71 TYTQICNWFANWRRKLKNSEREKAKKSWGHLIKNYNHNARGNVEQFSISSEDSIWEEEMHSCPAE 135
            |..|:.|||||.||:|||:.|: ...||...||.||...:||.|:.|:||.|.       || :|
  Rat   112 TLVQVSNWFANARRRLKNTVRQ-PDLSWALRIKLYNKYVQGNAERLSVSSADD-------SC-SE 167

  Fly   136 DDEGDD----NEEFSSHSTGSDGNANNEPSSPYKPILFVGSAGLTE-RISAQTGGKTKYKHQMME 195
            |.|...    |||  .:||.:........||..|      :.|..| |.:.......|||..::.
  Rat   168 DGENPPRTHMNEE--GYSTPAHHTVIKGESSAIK------AGGRPESRAAEDYVSPPKYKSSLLN 224

  Fly   196 KYMRDS---STAKTTSQQGTQLNKWLESAAKFTPDRNNYHIEWNMTRQKASSNSSCGQAIFTTDV 257
            :|:.||   ..|.:|:..|....:  ..:..|:.:      |:.......||:.:.|..::.||.
  Rat   225 RYLNDSLRHVMATSTAMMGKTRRR--NHSGSFSSN------EFEEELVSPSSSETEGTFVYRTDT 281

  Fly   258 SGAG-------------RGGRWMLHHKDELEAAEALANLA 284
            ...|             ||......|..|:.||.||.|||
  Rat   282 PDIGSTKGDKGDSTANRRGPSKDDTHWKEINAAMALTNLA 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 18/37 (49%)
MkxXP_008770033.2 Homeobox_KN 87..126 CDD:399131 19/38 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345350
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I5021
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D283391at33208
OrthoFinder 1 1.000 - - FOG0007188
OrthoInspector 1 1.000 - - oto96891
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11211
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4615
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.