DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and MKX

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001229631.1 Gene:MKX / 283078 HGNCID:23729 Length:352 Species:Homo sapiens


Alignment Length:273 Identity:87/273 - (31%)
Similarity:121/273 - (44%) Gaps:48/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KRLFTPDIKRMLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICNWFANWRRKLKNSEREKAKK 96
            ||....|:.|.||.||.:.|:||||::.||..||..:.:|..|:.|||||.||:|||:.|: ...
Human    74 KRQALQDMARPLKQWLYKHRDNPYPTKTEKILLALGSQMTLVQVSNWFANARRRLKNTVRQ-PDL 137

  Fly    97 SWGHLIKNYNHNARGNVEQFSISSEDSIWEEEMHSCPAEDDEGDDNEEFSSHSTGSDGNANNEPS 161
            ||...||.||...:||.|:.|:||:|        || :||.|.......      ::|..|....
Human   138 SWALRIKLYNKYVQGNAERLSVSSDD--------SC-SEDGENPPRTHM------NEGGYNTPVH 187

  Fly   162 SP-YKPILFVGSAGL--TERISAQTGGKTKYKHQMMEKYMRDS---STAKTTSQQGTQLNKWLES 220
            .| .|....|..||:  ..|.|.......|||..::.:|:.||   ..|..|:..|....:  ..
Human   188 HPVIKSENSVIKAGVRPESRASEDYVAPPKYKSSLLNRYLNDSLRHVMATNTTMMGKTRQR--NH 250

  Fly   221 AAKFTPDRNNYHIEWNMTRQKASSNSSCGQAIFTTDV---------SGAGRGGRWMLHHKD---- 272
            :..|:.:      |:.......||:.:.|..::.||.         |.|.|.|    ..||    
Human   251 SGSFSSN------EFEEELVSPSSSETEGNFVYRTDTLENGSNKGESAANRKG----PSKDDTYW 305

  Fly   273 -ELEAAEALANLA 284
             |:.||.||.|||
Human   306 KEINAAMALTNLA 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 18/37 (49%)
MKXNP_001229631.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..54
Homeobox_KN 88..127 CDD:399131 19/38 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 159..189 10/44 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..301 11/67 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151833
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I5060
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D283391at33208
OrthoFinder 1 1.000 - - FOG0007188
OrthoInspector 1 1.000 - - oto89776
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11211
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5569
SonicParanoid 1 1.000 - - X4615
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.