DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and Tgif2lx1

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_694749.1 Gene:Tgif2lx1 / 245583 MGIID:2387796 Length:231 Species:Mus musculus


Alignment Length:202 Identity:45/202 - (22%)
Similarity:83/202 - (41%) Gaps:42/202 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RMLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICNWFANWRRKLKNSEREKAKKSWGHLIKNY 105
            ::|:|||...:.|.||:..:|:.|:..|.|:|.|:.|||.|.|:.|:          |....|.|
Mouse    51 KILRDWLCEHQFNAYPTVADKRMLSKNTDLSYLQVSNWFVNIRKHLR----------WEIRYKPY 105

  Fly   106 NHNARGNVEQFSISSEDSIWEEEMHSCPAEDDEGDDNEEFSSHSTGSDGNANNEPSSPYKPILFV 170
            :.:..|.....:         ::.||.|:|:.:...||.............::|...||.     
Mouse   106 SLSHEGQAANAA---------QKQHSNPSEEVKTQFNENADMQDLPLPIRQDSEEKVPYL----- 156

  Fly   171 GSAGLTERISAQTGGKTKYKHQMMEKYMRDSSTAKTTSQQGTQLNKWLESAAKFTPDRNNYHIEW 235
             .:...:::.|:..         :||..:.|.|...:|.:..    |.|.    .||.:::::..
Mouse   157 -ESSPNQKVIAEDN---------IEKEEKISITEPWSSPEVA----WPEE----KPDFSSFYMLV 203

  Fly   236 NMTRQKA 242
            ::..|||
Mouse   204 DVAVQKA 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 15/37 (41%)
Tgif2lx1NP_694749.1 Homeobox_KN 56..94 CDD:283551 15/37 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.