DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and Tgif2

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_775572.1 Gene:Tgif2 / 228839 MGIID:1915299 Length:237 Species:Mus musculus


Alignment Length:197 Identity:48/197 - (24%)
Similarity:77/197 - (39%) Gaps:55/197 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KRNRRHSRRAWPPEEELHPASRATKRLFTPDIKRMLKDWLIRRRENPYPSREEKKQLAAETGLTY 72
            ||.||.:.    |:|.:                ::|:|||...|.|.|||.:||..|:.:|.|:.
Mouse    18 KRKRRGNL----PKESV----------------KILRDWLYLHRYNAYPSEQEKLSLSGQTNLSV 62

  Fly    73 TQICNWFANWRRK-LKNSEREKAKKSWGHLIKNYNHNA------RGNVEQF---SISSEDSIWEE 127
            .||||||.|.||: |.:..|:..|......|......|      ||:....   |:.:..::...
Mouse    63 LQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSLLAVSVPAPTNMLSL 127

  Fly   128 EMHSCPAEDDEGDDNEEFSSHSTGSDGNANNEPSSPYKPI-------LFVGSAGLTERISAQTGG 185
            .:.|.|....:|:                  :|::|:..:       |...::.||....|:.|.
Mouse   128 SVCSMPLHSGQGE------------------KPAAPFPQVELESPKALVTPASTLTLLTRAEAGS 174

  Fly   186 KT 187
            .|
Mouse   175 PT 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 19/37 (51%)
Tgif2NP_775572.1 Homeobox_KN 36..75 CDD:368670 20/38 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..106 2/18 (11%)
Repressive function 103..237 14/92 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..196 2/6 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..237
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0773
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.