DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and Pknox2

DIOPT Version :10

Sequence 1:NP_608502.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_683752.2 Gene:Pknox2 / 208076 MGIID:2445415 Length:474 Species:Mus musculus


Alignment Length:138 Identity:40/138 - (28%)
Similarity:62/138 - (44%) Gaps:40/138 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 MLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICNWFANWRRKL-------KNSE-REKAKKSW 98
            :::.||.:...:|||:.:||:|:||:|.||..|:.|||.|.||::       .|.: ..||||  
Mouse   302 IMRSWLFQHLMHPYPTEDEKRQIAAQTNLTLLQVNNWFINARRRILQPMLDASNPDPAPKAKK-- 364

  Fly    99 GHLIKNY---------NHNARGNVEQ------------------FSISSEDSIWEEEMHSCPAED 136
               ||:.         |..|.|.::|                  .|:||:::....:.....|.|
Mouse   365 ---IKSQHRPTQRFWPNSIAAGVLQQQGGTPGTNPDGSINLDNLQSLSSDNATMAMQQAMMAAHD 426

  Fly   137 DEGDDNEE 144
            |..|..||
Mouse   427 DSLDGTEE 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_608502.1 homeodomain 29..90 CDD:238039 21/54 (39%)
Pknox2NP_683752.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..42
PLN02983 <3..>66 CDD:215533
Meis_PKNOX_N 96..181 CDD:465140
Homeobox_KN 307..345 CDD:428673 18/37 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 351..371 7/24 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..405 1/19 (5%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 423..474 6/12 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.