powered by:
Protein Alignment CG11617 and Meis3
DIOPT Version :9
Sequence 1: | NP_001245817.1 |
Gene: | CG11617 / 33183 |
FlyBaseID: | FBgn0031232 |
Length: | 294 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_036008636.1 |
Gene: | Meis3 / 17537 |
MGIID: | 108519 |
Length: | 400 |
Species: | Mus musculus |
Alignment Length: | 68 |
Identity: | 28/68 - (41%) |
Similarity: | 42/68 - (61%) |
Gaps: | 2/68 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 EEELHPASRATKR--LFTPDIKRMLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICNWFANWR 83
:|:|....|..|: :|......:::.||.:...:||||.|:|||||.:||||..|:.|||.|.|
Mouse 278 DEDLDLERRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINAR 342
Fly 84 RKL 86
|::
Mouse 343 RRI 345
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0773 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.900 |
|
Return to query results.
Submit another query.