DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and meis1a

DIOPT Version :10

Sequence 1:NP_608502.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_571972.2 Gene:meis1a / 170455 ZFINID:ZDB-GENE-020122-3 Length:380 Species:Danio rerio


Alignment Length:94 Identity:26/94 - (27%)
Similarity:51/94 - (54%) Gaps:15/94 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PKRNRRHSRRAWPPEEELHPASRATKRLFTPDIKRMLKDWLIRRRENPYPSREEKKQLAAETGLT 71
            |.:.|:::::               :.:|......:::.||.:...:||||.|:|:||:.:||||
Zfish   255 PDKERKNNKK---------------RGIFPKVATNIMRAWLFQHLTHPYPSEEQKRQLSQDTGLT 304

  Fly    72 YTQICNWFANWRRKLKNSEREKAKKSWGH 100
            ..|:.|||.|.||::.....:::.::.||
Zfish   305 ILQVNNWFINARRRIVQPMIDQSNRAVGH 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_608502.1 homeodomain 29..90 CDD:238039 22/60 (37%)
meis1aNP_571972.2 Meis_PKNOX_N 99..183 CDD:465140
Homeobox_KN 280..318 CDD:428673 19/37 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.