Sequence 1: | NP_001245817.1 | Gene: | CG11617 / 33183 | FlyBaseID: | FBgn0031232 | Length: | 294 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001127694.1 | Gene: | IRX2 / 153572 | HGNCID: | 14359 | Length: | 471 | Species: | Homo sapiens |
Alignment Length: | 210 | Identity: | 58/210 - (27%) |
---|---|---|---|
Similarity: | 81/210 - (38%) | Gaps: | 70/210 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 ATKRLFTPDIKRMLKDWLIRRRENPYPSREEKKQLAAETGLTYTQICNWFANWRRKLKNSEREKA 94
Fly 95 KKSW-------------GHLIKNYNHNARGNVEQFSISSED---SIWEEEM--HSCPA------- 134
Fly 135 ----------------------EDDEGDDNEEFSSHSTGSDGNANNEPSSPYKPILFVGSAGLTE 177
Fly 178 RI------SAQTGGK 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11617 | NP_001245817.1 | Homeobox_KN | 46..84 | CDD:283551 | 19/37 (51%) |
IRX2 | NP_001127694.1 | Homeobox_KN | 132..171 | CDD:283551 | 20/38 (53%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 176..373 | 30/146 (21%) | |||
IRO | 322..339 | CDD:214716 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 424..471 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0773 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |