DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11617 and mkx

DIOPT Version :9

Sequence 1:NP_001245817.1 Gene:CG11617 / 33183 FlyBaseID:FBgn0031232 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_031760383.1 Gene:mkx / 100493638 XenbaseID:XB-GENE-853539 Length:350 Species:Xenopus tropicalis


Alignment Length:311 Identity:90/311 - (28%)
Similarity:130/311 - (41%) Gaps:84/311 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RPKRNR------RHSRRAWPPEEELHPASRATKRLFTPDIKRMLKDWLIRRRENPYPSREEKKQL 64
            ||..:|      ||.|:|                  ..|:.|.||.||.:.|:||||::.||..|
 Frog    58 RPGSSRGASGKVRHKRQA------------------LQDMARPLKQWLYKHRDNPYPTKTEKILL 104

  Fly    65 AAETGLTYTQICNWFANWRRKLKNSEREKAKKSWGHLIKNYNHNARGNVEQFSISSEDSIWEEEM 129
            |..:.:|..|:.|||||.||:|||:.|: ...||...||.||...:||.|:.|:||||       
 Frog   105 ALGSQMTLVQVSNWFANARRRLKNTVRQ-PDLSWALRIKLYNKYVQGNAERLSVSSED------- 161

  Fly   130 HSCPAEDDEGDDNEEFSSHSTGSDGNANNEPSSPYKPILFVGSAGLTERISAQTGGK------TK 188
             || :||.|   |...|.|:.    .|.::|.  :..::...|:.:...:.|::...      .|
 Frog   162 -SC-SEDGE---NAPRSHHNE----EAYDKPI--HHTVITKESSVIKSGVRAESSASEDYVSPPK 215

  Fly   189 YKHQMMEKYMRDSSTAKTTSQQGTQLNKWLESAAKFTPDRNNYHI------EWNMTRQKASSNSS 247
            ||..::.:|:.||......|           :||.....|...|.      |:.......||:.:
 Frog   216 YKSSLLHRYLNDSLRHVMAS-----------NAAMREKTRQRNHSGSFSSNEFEEELVSPSSSET 269

  Fly   248 CGQAIFTTDV---------SGAGRGGRWMLHHKD-----ELEAAEALANLA 284
            .|..::.||.         |...:.|.    .||     |:.||.||.|||
 Frog   270 EGNFVYRTDTLESAANKCQSAVNKEGA----SKDETYWREINAAMALTNLA 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11617NP_001245817.1 Homeobox_KN 46..84 CDD:283551 18/37 (49%)
mkxXP_031760383.1 Homeobox_KN 86..125 CDD:399131 19/38 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I4941
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D283391at33208
OrthoFinder 1 1.000 - - FOG0007188
OrthoInspector 1 1.000 - - oto103585
Panther 1 1.100 - - LDO PTHR11211
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4615
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.160

Return to query results.
Submit another query.