DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL10 and MRPL11

DIOPT Version :9

Sequence 1:NP_523440.1 Gene:mRpL10 / 33182 FlyBaseID:FBgn0031231 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_010079.1 Gene:MRPL11 / 851325 SGDID:S000002361 Length:249 Species:Saccharomyces cerevisiae


Alignment Length:194 Identity:41/194 - (21%)
Similarity:85/194 - (43%) Gaps:41/194 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 RNWLDHSRLVAFFHLSSI--TADDIFRVRVQLHKQNLHLKSYGSKIIEQAVKNTRYEA------- 140
            ::.:::|.::.|.|.:::  |.|..||.::         |..|.|:.:  |:|..:|.       
Yeast    58 KHLMENSSMIFFVHYNNLSKTEDHHFRFKI---------KQTGGKLTK--VRNNLFEVYLRNSHL 111

  Fly   141 -----------------IVPLFHSNHCIVFSPD--PEKTAALLRIVRRV-PQMVLLGGIVEETML 185
                             ::||.......:...|  |::.|.||::::.. .:::::|..||..:|
Yeast   112 PDPCGFVKRKEQNWKHPLLPLLKGPTATITYEDTNPQQVAKLLKVLQSAQDKLMVIGAKVENEVL 176

  Fly   186 SRNQLVAYAQMPGLHAVQAQLVQTLSQAPG-HLIQQLQAHQNSFVQVLDVHAKNQMNEETPKST 248
            :..::..:..:|....:|:|||..|....| .|::.|:...|:....|..|..||..:|..:||
Yeast   177 NVEKINTFKTLPTKPEMQSQLVSVLQMLSGLGLVRTLENSSNALYLTLKSHNDNQKPKEDVEST 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL10NP_523440.1 Ribosomal_L10 74..227 CDD:240223 33/171 (19%)
MRPL11NP_010079.1 RplJ 48..232 CDD:223322 37/184 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11560
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.