DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL10 and AT3G12370

DIOPT Version :9

Sequence 1:NP_523440.1 Gene:mRpL10 / 33182 FlyBaseID:FBgn0031231 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_187843.1 Gene:AT3G12370 / 820415 AraportID:AT3G12370 Length:171 Species:Arabidopsis thaliana


Alignment Length:156 Identity:36/156 - (23%)
Similarity:68/156 - (43%) Gaps:24/156 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 IIAREVRNWLDHSRLVAFFHLSSITADDIFRVRVQLHKQNLHLKSYGSK--IIEQAVKNTRYEAI 141
            ::|.:.:..|::...:...:.:.::...:..:|..| ::|.:.|...:|  ::.:|::.|::|::
plant     9 LVAGKTKINLENCHFITGINYNGLSVKQLQELRGIL-RENTNTKLLVAKNTLVYKALEGTKWESL 72

  Fly   142 VPLFHSNHCIVFSPDPEKTAALLRIVRRVPQMVL----LGGI-------------VEETMLSRNQ 189
            .|.....:..:|....:..|||...:....:..|    |||.             |.|||.||..
plant    73 KPCMKGMNAWLFVQSEDIPAALKTFINFQKEKKLYDNNLGGAVFEEKLYAPQDYKVIETMPSRAD 137

  Fly   190 LVAYAQMPG-LHAVQAQLVQTLSQAP 214
            :  |..|.| ||.....||..| |||
plant   138 V--YGMMLGSLHWPALDLVNAL-QAP 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL10NP_523440.1 Ribosomal_L10 74..227 CDD:240223 36/156 (23%)
AT3G12370NP_187843.1 Ribosomal_L10 9..162 CDD:240223 36/156 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11560
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.