DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL10 and Mrpl10

DIOPT Version :9

Sequence 1:NP_523440.1 Gene:mRpL10 / 33182 FlyBaseID:FBgn0031231 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_001103090.1 Gene:Mrpl10 / 691075 RGDID:1588626 Length:262 Species:Rattus norvegicus


Alignment Length:265 Identity:65/265 - (24%)
Similarity:132/265 - (49%) Gaps:37/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATLIQRSLSLAKSSTPALQFLRFRGKINIQRPKAPHYERARVVAVTQ-------------PKYP 52
            :|.:::..|.......|.||.:|...|...:..:..|::|.:::|:|:             |..|
  Rat     5 VACILRGGLPPRAGWLPTLQPVRHGSKAVTRHRRVMHFQRQKLMAITEYIPPRPAVSPRCLPPPP 69

  Fly    53 ELPKAKSCFKTRAERTQQQQENPYNEIIAREVRNWLDHSRLVAFFHLSSITADDIFRVRVQLHKQ 117
            :.||               :|:....::.|::......:|::|.....:::|:|...:|.||.|.
  Rat    70 KPPK---------------EESGLIRLLRRDIAAVFRDNRMIAVCQNVALSAEDKLLLRHQLRKH 119

  Fly   118 NLHLKSYGSKIIEQAVKNTRYEAIVPLFHSNHCIVFSPDPEKTAALLRIVRRVPQMVLLGGIVEE 182
            .:.:|.:.|::::..:::::|:.::|||..::.::.|.:| |...::||::.||.:.||||.:::
  Rat   120 KIFIKVFPSQVLKPFLEDSKYQNLLPLFVGHNLLLVSEEP-KVKEMVRILKSVPFLPLLGGCIDD 183

  Fly   183 TMLSRNQLVAYAQMPGLHAVQAQLVQTLSQAPGHLIQQ----LQAHQNSFVQVLDVHAKNQMNEE 243
            |:|||...|.||::|.|..:|.:||..|:    ||..|    ||........:||.:.:.|...:
  Rat   184 TILSRQGFVEYAKLPSLDRLQGELVGGLT----HLTAQTRYLLQHQPVQLTSLLDQYVRQQHEGD 244

  Fly   244 TPKST 248
            ...||
  Rat   245 CATST 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL10NP_523440.1 Ribosomal_L10 74..227 CDD:240223 44/156 (28%)
Mrpl10NP_001103090.1 Ribosomal_L10 81..228 CDD:240223 44/151 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41665
Inparanoid 1 1.050 100 1.000 Inparanoid score I4903
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1484426at2759
OrthoFinder 1 1.000 - - FOG0006173
OrthoInspector 1 1.000 - - oto97118
orthoMCL 1 0.900 - - OOG6_107552
Panther 1 1.100 - - LDO PTHR11560
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.