DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL10 and Mrpl10

DIOPT Version :9

Sequence 1:NP_523440.1 Gene:mRpL10 / 33182 FlyBaseID:FBgn0031231 Length:248 Species:Drosophila melanogaster
Sequence 2:NP_080430.1 Gene:Mrpl10 / 107732 MGIID:1333801 Length:262 Species:Mus musculus


Alignment Length:259 Identity:68/259 - (26%)
Similarity:133/259 - (51%) Gaps:38/259 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATLIQRSLSLAKSSTPALQFLRFRGKINIQRPKAPHYERARVVAVTQ-------------PKYP 52
            :|.:::..|....:..|.||.:|...|...:..:..|::|.:::|:|:             |..|
Mouse     5 VAGILRGGLPPRAAWLPTLQTVRHGSKAVTRHWRVMHFQRQKLMAITEYIPPKPAINPRCLPPPP 69

  Fly    53 ELPKAKSCFKTRAERTQQQQENPYNEIIAREVRNWLDHSRLVAFFHLSSITADDIFRVRVQLHKQ 117
            :.||               :|:....::.:::......:|::|.....:::|:|...:|.||.|.
Mouse    70 KPPK---------------EESGLVRLLRQDIVAVFRDNRMIAVCQNVALSAEDKLLLRHQLRKH 119

  Fly   118 NLHLKSYGSKIIEQAVKNTRYEAIVPLFHSNHCIVFSPDPEKTAALLRIVRRVPQMVLLGGIVEE 182
            .:.:|.:.|::::..::|::|..::|||..::.::.|.:| |...::|:::.||.:.||||.|::
Mouse   120 KIFIKVFPSQVLKPFLENSKYRNLLPLFVGHNLLLVSEEP-KVKEMVRVLKSVPFLPLLGGCVDD 183

  Fly   183 TMLSRNQLVAYAQMPGLHAVQAQLVQTLSQAPGHLIQQ----LQAHQNSFVQVLDVHAKNQMNE 242
            |:|||..||.||::|.|..:|.|||..|:    ||:.|    ||........:||.:.|.| ||
Mouse   184 TILSRQGLVDYAKLPSLDQLQGQLVGGLT----HLMAQTRYLLQHQPVQLTSLLDQYVKEQ-NE 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL10NP_523440.1 Ribosomal_L10 74..227 CDD:240223 46/156 (29%)
Mrpl10NP_080430.1 Ribosomal_L10 81..228 CDD:240223 46/151 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..262 68/259 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4241
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41665
Inparanoid 1 1.050 99 1.000 Inparanoid score I4997
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006173
OrthoInspector 1 1.000 - - oto93581
orthoMCL 1 0.900 - - OOG6_107552
Panther 1 1.100 - - LDO PTHR11560
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3837
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.