DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL10 and mrpl10

DIOPT Version :9

Sequence 1:NP_523440.1 Gene:mRpL10 / 33182 FlyBaseID:FBgn0031231 Length:248 Species:Drosophila melanogaster
Sequence 2:XP_031750249.1 Gene:mrpl10 / 100496025 XenbaseID:XB-GENE-947066 Length:243 Species:Xenopus tropicalis


Alignment Length:250 Identity:72/250 - (28%)
Similarity:133/250 - (53%) Gaps:15/250 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATLIQRSLSLAKSSTPALQFLRFRGKINIQRPKAPHYERARVVAVTQ---PKYPELPKAKSCFK 62
            ||..:.|.........|:||.:|...|...:..||.|:||.::||:|:   || |.:|  :.|..
 Frog     1 MAAALVRGAVREVGWLPSLQCVRHGSKAVTRHRKAMHFERQKMVALTEYIAPK-PTMP--ERCVA 62

  Fly    63 TRAERTQQQQENPYNEIIAREVRNWLDHSRLVAFFHLSSITADDIFRVRVQLHKQNLHLKSYGSK 127
            .:.:.::..:|||..:::..::|..|...::||.|..|:..|:|:..:|.:|.|.::|:|.:..:
 Frog    63 PQPKPSEMVKENPLEQLLCSQLRTVLQDCKMVAVFQRSAAGAEDLLHLRHRLLKHDIHMKHFPLQ 127

  Fly   128 IIEQAVKNTRYEAIVPLFHSNHCIVFSPDPEKTAALLRIVRRVPQMVLLGGIVEETMLSRNQLVA 192
            ::.:.:.::...:::|||..:..::.|.: .|...:|:.||.:||:.|||..||..:|||..:|.
 Frog   128 VVRKTLADSHLSSMLPLFIGHTFLIVSHE-VKVKQMLQCVRSLPQVQLLGACVENRLLSRQGVVN 191

  Fly   193 YAQMPGLHAVQAQLVQTL----SQAPGHLIQQLQAHQNSFVQVLDVHAKNQMNEE 243
            |:::|.|..::.|:|..|    |..|..|.|    |......:||.|.|.:..|:
 Frog   192 YSRLPSLEVLRGQVVAGLALMASLTPSLLTQ----HSVKLGALLDQHIKQKSAEQ 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL10NP_523440.1 Ribosomal_L10 74..227 CDD:240223 45/156 (29%)
mrpl10XP_031750249.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41665
Inparanoid 1 1.050 109 1.000 Inparanoid score I4753
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1484426at2759
OrthoFinder 1 1.000 - - FOG0006173
OrthoInspector 1 1.000 - - oto103814
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.