DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3436 and wds

DIOPT Version :9

Sequence 1:NP_001285543.1 Gene:CG3436 / 33180 FlyBaseID:FBgn0031229 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster


Alignment Length:301 Identity:99/301 - (32%)
Similarity:157/301 - (52%) Gaps:13/301 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYEDCENVMAMSGHSGAVMEAHFTPDGSHIFT 115
            |.||...:...:|.|.||.|.||..|:.|.||..| |.:....:|||...:.:..::.|...:.:
  Fly    68 LAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAY-DGKFEKTISGHKLGISDVAWSSDSRLLVS 131

  Fly   116 CSTDKTLAFWDIATGQRQRRFKGHGNFVNSVQGSRRGQQLLCSGSDDRTIKIWDARKKHAAHTLE 180
            .|.||||..|:::||:..:..|||.|:|.....:.: ..|:.|||.|.:::|||.|......||.
  Fly   132 GSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQ-SNLIVSGSFDESVRIWDVRTGKCLKTLP 195

  Fly   181 SPFQ-VTAVCFGDTGEQVISGGIDNEVKIWDIRK-QAVLHHLRGHSDTITGMSLSPEGDFILTNA 243
            :... |:||.|...|..::|...|...:|||... |.:...:...:..::.:..||.|.:||...
  Fly   196 AHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAAT 260

  Fly   244 MDNTLRVWDVRPYAPGERCVKVFQGHQHNFEKNLLRCAWS-PGSDKITSGSADRHVYIWDVNTRR 307
            :||||::||   |:.| :|:|.:.||::  ||..:...:| .|...|.|||.|..||||::.::.
  Fly   261 LDNTLKLWD---YSKG-KCLKTYTGHKN--EKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKE 319

  Fly   308 ILYKLPGHNGSVNAVDFSPKEPLILSGS--SDKTLYLGEID 346
            ::.||.||..:|......|.|.:|.|.:  :|||:.|.:.|
  Fly   320 VVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLWKSD 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3436NP_001285543.1 WD40 <19..346 CDD:225201 98/299 (33%)
WD40 50..342 CDD:238121 97/295 (33%)
WD40 repeat 58..96 CDD:293791 13/37 (35%)
WD40 repeat 102..138 CDD:293791 9/35 (26%)
WD40 repeat 143..180 CDD:293791 11/36 (31%)
WD40 repeat 186..221 CDD:293791 10/35 (29%)
WD40 repeat 227..267 CDD:293791 15/39 (38%)
WD40 repeat 277..313 CDD:293791 12/36 (33%)
WD40 repeat 319..342 CDD:293791 8/24 (33%)
wdsNP_001245503.1 WD40 64..358 CDD:238121 98/297 (33%)
WD40 repeat 75..112 CDD:293791 13/37 (35%)
WD40 repeat 118..154 CDD:293791 9/35 (26%)
WD40 repeat 159..195 CDD:293791 11/36 (31%)
WD40 repeat 202..237 CDD:293791 10/34 (29%)
WD40 repeat 244..280 CDD:293791 15/39 (38%)
WD40 repeat 288..325 CDD:293791 12/36 (33%)
WD40 repeat 331..357 CDD:293791 8/25 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442323
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46868
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.