Sequence 1: | NP_001285543.1 | Gene: | CG3436 / 33180 | FlyBaseID: | FBgn0031229 | Length: | 347 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001263071.1 | Gene: | CG7568 / 43482 | FlyBaseID: | FBgn0039673 | Length: | 482 | Species: | Drosophila melanogaster |
Alignment Length: | 266 | Identity: | 77/266 - (28%) |
---|---|---|---|
Similarity: | 119/266 - (44%) | Gaps: | 38/266 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 GHEGEIFTAEFHP-EGELLLSSGFDRQIYIWQVYEDCENVMAMSGHSGAVMEAHFTPDGSHIFTC 116
Fly 117 STDKTLAFWDIATGQRQRRFKGH----GNFVNSVQGSRRGQQLLCSGSDDRTIKIWDARK----- 172
Fly 173 ----KHAAHTLESPFQVTAVCFGDTGEQVISGGIDNEVKIWDIRKQAVLHHL---RGHSDTITGM 230
Fly 231 SLSPEGDFILTNAMDNTLRVWDVRPYAPGERCVKVFQGHQHNFEKNLLRCAWSPGSDKITSGSAD 295
Fly 296 RHVYIW 301 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3436 | NP_001285543.1 | WD40 | <19..346 | CDD:225201 | 77/266 (29%) |
WD40 | 50..342 | CDD:238121 | 77/266 (29%) | ||
WD40 repeat | 58..96 | CDD:293791 | 10/38 (26%) | ||
WD40 repeat | 102..138 | CDD:293791 | 10/35 (29%) | ||
WD40 repeat | 143..180 | CDD:293791 | 14/45 (31%) | ||
WD40 repeat | 186..221 | CDD:293791 | 7/37 (19%) | ||
WD40 repeat | 227..267 | CDD:293791 | 12/39 (31%) | ||
WD40 repeat | 277..313 | CDD:293791 | 8/25 (32%) | ||
WD40 repeat | 319..342 | CDD:293791 | |||
CG7568 | NP_001263071.1 | WD40 | 93..466 | CDD:225201 | 76/264 (29%) |
WD40 repeat | 122..158 | CDD:293791 | |||
WD40 | 154..467 | CDD:238121 | 77/266 (29%) | ||
WD40 repeat | 189..222 | CDD:293791 | 77/266 (29%) | ||
WD40 repeat | 228..265 | CDD:293791 | 10/37 (27%) | ||
WD40 repeat | 270..306 | CDD:293791 | 11/35 (31%) | ||
WD40 repeat | 314..348 | CDD:293791 | 14/38 (37%) | ||
WD40 repeat | 355..393 | CDD:293791 | 8/44 (18%) | ||
WD40 repeat | 400..436 | CDD:293791 | 12/39 (31%) | ||
WD40 repeat | 442..466 | CDD:293791 | 7/23 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45442320 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |