DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3436 and CG7568

DIOPT Version :9

Sequence 1:NP_001285543.1 Gene:CG3436 / 33180 FlyBaseID:FBgn0031229 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster


Alignment Length:266 Identity:77/266 - (28%)
Similarity:119/266 - (44%) Gaps:38/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GHEGEIFTAEFHP-EGELLLSSGFDRQIYIWQVYEDCENVMAMSGHSGAVMEAHFTPDGSHIFTC 116
            ||..|:..||||| :|:.:.::..|....|:.| |....:..::.|...|:.|.|..||..:.|.
  Fly   222 GHTAELVAAEFHPVDGKSIATASLDGSARIYDV-ETSHELQQLTHHGAEVIAARFNRDGQMLLTG 285

  Fly   117 STDKTLAFWDIATGQRQRRFKGH----GNFVNSVQGSRRGQQLLCSGSDDRTIKIWDARK----- 172
            |.|.:.|.||:.:.....:.:||    .|.|.:..||     |:.:||.|.|.:|||.||     
  Fly   286 SFDHSAAIWDVRSKSLGHQLRGHSAELSNCVWNFSGS-----LIATGSLDNTARIWDTRKLDQEL 345

  Fly   173 ----KHAAHTLESPFQVTAVCFGDTGEQVISGGIDNEVKIWDIRKQAVLHHL---RGHSDTITGM 230
                :|:...|:       |.|...|:.:.:...|...::|.:...:.|..|   .||||.::.:
  Fly   346 YLAARHSDEVLD-------VSFDAAGQLLATCSSDCTARVWRLEGSSELEMLSLMAGHSDEVSKV 403

  Fly   231 SLSPEGDFILTNAMDNTLRVWDVRPYAPGERCVKVFQGHQHNFEKNLLRCAWSPGSDKITSGSAD 295
            ..||.|..:||.:.|||.|:|    .....:|.:|..||    |..:..||:|...|.|.:.|.|
  Fly   404 CFSPSGCMLLTASADNTARLW----LTESGQCSQVLAGH----EGEVFSCAYSYAGDAILTASKD 460

  Fly   296 RHVYIW 301
            .....|
  Fly   461 NSCRFW 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3436NP_001285543.1 WD40 <19..346 CDD:225201 77/266 (29%)
WD40 50..342 CDD:238121 77/266 (29%)
WD40 repeat 58..96 CDD:293791 10/38 (26%)
WD40 repeat 102..138 CDD:293791 10/35 (29%)
WD40 repeat 143..180 CDD:293791 14/45 (31%)
WD40 repeat 186..221 CDD:293791 7/37 (19%)
WD40 repeat 227..267 CDD:293791 12/39 (31%)
WD40 repeat 277..313 CDD:293791 8/25 (32%)
WD40 repeat 319..342 CDD:293791
CG7568NP_001263071.1 WD40 93..466 CDD:225201 76/264 (29%)
WD40 repeat 122..158 CDD:293791
WD40 154..467 CDD:238121 77/266 (29%)
WD40 repeat 189..222 CDD:293791 77/266 (29%)
WD40 repeat 228..265 CDD:293791 10/37 (27%)
WD40 repeat 270..306 CDD:293791 11/35 (31%)
WD40 repeat 314..348 CDD:293791 14/38 (37%)
WD40 repeat 355..393 CDD:293791 8/44 (18%)
WD40 repeat 400..436 CDD:293791 12/39 (31%)
WD40 repeat 442..466 CDD:293791 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442320
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.