DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3436 and Lis-1

DIOPT Version :9

Sequence 1:NP_001285543.1 Gene:CG3436 / 33180 FlyBaseID:FBgn0031229 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001246361.1 Gene:Lis-1 / 36791 FlyBaseID:FBgn0015754 Length:411 Species:Drosophila melanogaster


Alignment Length:311 Identity:83/311 - (26%)
Similarity:136/311 - (43%) Gaps:54/311 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LMAYTNRDKAL----LESGVRRTSNLQAPIMQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQ 83
            ||...:.|..:    .|:|....|        |:||...:....|..:|:||.|...|..|.:|.
  Fly   122 LMVSASEDATIRIWDFETGEYERS--------LKGHTDSVQDVAFDAQGKLLASCSADLSIKLWD 178

  Fly    84 VYEDCENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTLAFWDIATGQRQRRFKGHGNFVNSVQG 148
            ..:..|.:..|.||...|....|.|.|.::.:.|.|:|:..|::|||...:.:.||..:|..|:.
  Fly   179 FQQSYECIKTMHGHDHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGHREWVRMVRV 243

  Fly   149 SRRGQQLLCSGSDDRTIKIWDARKKHA-------AHTLE----SPFQVTAVCFGDT--------- 193
            ...| .:..:.|:|:||::|....|..       .||:|    :| :..|....:.         
  Fly   244 HIEG-SIFATCSNDQTIRVWLTNSKDCKVELRDHEHTVECIAWAP-EAAASAINEAAGADNKKGH 306

  Fly   194 --GEQVISGGIDNEVKIWDIRKQAVLHHLRGHSDTITGMSLSPEGDFILTNAMDNTLRVWDVRPY 256
              |..:.||..|..::|||:.....|..|.||.:.:.|::..|.|.::::.:.|.|:||||:|  
  Fly   307 HQGPFLASGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDLR-- 369

  Fly   257 APGERCVKVFQGHQH-----NFEKNLLRCAWSPGSDKITSGSADRHVYIWD 302
              .:||:|....|||     :|.|         ....:.|||.|:.|.:|:
  Fly   370 --NKRCMKTLYAHQHFCTSIDFHK---------AHPYVISGSVDQTVKVWE 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3436NP_001285543.1 WD40 <19..346 CDD:225201 83/311 (27%)
WD40 50..342 CDD:238121 77/280 (28%)
WD40 repeat 58..96 CDD:293791 10/37 (27%)
WD40 repeat 102..138 CDD:293791 10/35 (29%)
WD40 repeat 143..180 CDD:293791 11/43 (26%)
WD40 repeat 186..221 CDD:293791 9/45 (20%)
WD40 repeat 227..267 CDD:293791 13/39 (33%)
WD40 repeat 277..313 CDD:293791 6/26 (23%)
WD40 repeat 319..342 CDD:293791
Lis-1NP_001246361.1 LisH 9..40 CDD:128913
WD40 100..409 CDD:238121 82/309 (27%)
WD40 repeat 111..148 CDD:293791 7/33 (21%)
WD40 repeat 154..191 CDD:293791 10/36 (28%)
WD40 repeat 196..232 CDD:293791 11/35 (31%)
WD40 repeat 239..274 CDD:293791 8/35 (23%)
WD40 repeat 280..336 CDD:293791 11/56 (20%)
WD40 repeat 342..378 CDD:293791 13/39 (33%)
WD40 repeat 384..408 CDD:293791 7/32 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442326
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.