DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3436 and Wdr81

DIOPT Version :9

Sequence 1:NP_001285543.1 Gene:CG3436 / 33180 FlyBaseID:FBgn0031229 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_609535.1 Gene:Wdr81 / 34616 FlyBaseID:FBgn0032395 Length:1953 Species:Drosophila melanogaster


Alignment Length:214 Identity:48/214 - (22%)
Similarity:78/214 - (36%) Gaps:63/214 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 GHSGAVMEAHFTPDGSHIFTCSTDKTLAFWDI-------ATGQRQRRFKGHGNFVNSVQGSRRG- 152
            ||:.:|...:...:.:...:.|.|||:..|.:       .|...|..:..|...:||:     | 
  Fly  1656 GHTNSVRAIYALDNENSFISASKDKTVKLWSLRSEGDGRKTSACQFTYTAHKKSINSL-----GF 1715

  Fly   153 -QQLLCSGSDDRTIKIWDARKKHAAHTLESP--FQVTAV-CFGDTGEQVISGGIDNEVKIWDIRK 213
             :.|....|.|..|.:||.........|::|  ..||.| |.......||:|..::.||:.|.|.
  Fly  1716 LESLRYVVSCDSGIHLWDPFIGRPLSVLDAPRHSAVTVVKCLPSHSPLVIAGTAESTVKMVDARS 1780

  Fly   214 QAVLHHLR-------------------------GHS-------DTITGMSL-------------- 232
            ...::..|                         |.|       ||.|||.:              
  Fly  1781 CEYVNEWRVCNASLPNATVRCLAVAPSGNWLAAGLSSGCIVQLDTRTGMVINSWRPMECDLLQLA 1845

  Fly   233 SPEGDFILTNAMDNTLRVW 251
            :|...|::::|:|::|.||
  Fly  1846 APSDQFLVSSALDHSLAVW 1864

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3436NP_001285543.1 WD40 <19..346 CDD:225201 48/214 (22%)
WD40 50..342 CDD:238121 48/214 (22%)
WD40 repeat 58..96 CDD:293791 48/214 (22%)
WD40 repeat 102..138 CDD:293791 7/42 (17%)
WD40 repeat 143..180 CDD:293791 9/38 (24%)
WD40 repeat 186..221 CDD:293791 10/35 (29%)
WD40 repeat 227..267 CDD:293791 10/39 (26%)
WD40 repeat 277..313 CDD:293791
WD40 repeat 319..342 CDD:293791
Wdr81NP_609535.1 Beach 345..588 CDD:100117
WD40 <1644..1877 CDD:225201 48/214 (22%)
WD40 1651..1876 CDD:295369 48/214 (22%)
WD40 repeat 1662..1705 CDD:293791 7/42 (17%)
WD40 repeat 1710..1744 CDD:293791 9/38 (24%)
WD40 repeat 1752..1788 CDD:293791 10/35 (29%)
WD40 repeat 1799..1836 CDD:293791 7/36 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442327
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.