DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3436 and Rbcn-3B

DIOPT Version :9

Sequence 1:NP_001285543.1 Gene:CG3436 / 33180 FlyBaseID:FBgn0031229 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001284797.1 Gene:Rbcn-3B / 31155 FlyBaseID:FBgn0023510 Length:1525 Species:Drosophila melanogaster


Alignment Length:311 Identity:67/311 - (21%)
Similarity:116/311 - (37%) Gaps:82/311 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PIMQ-LEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYE-DCENVMAMSGHSGAVMEAHFTPD 109
            |.|: |:|..|:          ..||....:..|.:|.|.| ..:|:        ::::|...|.
  Fly   321 PAMKLLQGAGGQ----------HNLLRGDSEGYISVWNVPEVPLDNI--------SILQAKQMPP 367

  Fly   110 ---GSHIFTCSTDKTLAFWDI-------ATGQRQRRFKGHGNFVNSV---QGSRRGQQLLCSGSD 161
               ..|:.|...:.    |.|       ...|..|..:......:|:   |.||     |..|.:
  Fly   368 RPLKPHVCTSLVEA----WSIMDPPPVGILDQLSRITESPVKLTSSIYLPQQSR-----LVIGRE 423

  Fly   162 DRTIKIWDARKKHAAHTLE------SPFQVTAVCFGDTG-----------------EQVISGGID 203
            |.:|.|..|.:......|.      |.:....:.:|..|                 ..::|||||
  Fly   424 DGSIVIVPATQTVMMQLLVGIKQNFSDWPSHQILYGHRGRVNCLLCPSMIHSRYEKSHLLSGGID 488

  Fly   204 NEVKIWDIRKQAVLHHLRGHSDTITGMSLSPEG------DFILTNAMDNTLRVWDVRPYAPGERC 262
            ..|.:||:...::||....|:..||.:.:.||.      ..|.:.|.|:::.:..::.    .:|
  Fly   489 FAVCLWDLYSGSLLHRFCVHAGEITQLLVPPESCSPRILKCICSVASDHSVTLVSLQE----RKC 549

  Fly   263 VKVFQGHQHNFEKNLLRCAWSPGSDKITSGSADRHVYIWDVNT---RRILY 310
            |.:  ..:|.|.  ::...|.|..|.:..|.:|..||:|.:.|   .|:|:
  Fly   550 VTL--ASRHLFP--VVTIKWRPLDDFLIVGCSDGSVYVWQMETGHLDRVLH 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3436NP_001285543.1 WD40 <19..346 CDD:225201 67/311 (22%)
WD40 50..342 CDD:238121 65/308 (21%)
WD40 repeat 58..96 CDD:293791 7/38 (18%)
WD40 repeat 102..138 CDD:293791 8/45 (18%)
WD40 repeat 143..180 CDD:293791 10/39 (26%)
WD40 repeat 186..221 CDD:293791 12/51 (24%)
WD40 repeat 227..267 CDD:293791 9/45 (20%)
WD40 repeat 277..313 CDD:293791 11/37 (30%)
WD40 repeat 319..342 CDD:293791
Rbcn-3BNP_001284797.1 WD40 <11..>204 CDD:225201
WD40 repeat 20..63 CDD:293791
WD40 <22..202 CDD:295369
WD40 repeat 68..107 CDD:293791
WD40 repeat 118..152 CDD:293791
WD40 repeat 160..204 CDD:293791
WD40 repeat 212..251 CDD:293791
WD40 repeat 406..459 CDD:293791 12/57 (21%)
WD40 <449..>607 CDD:225201 36/156 (23%)
WD40 453..>597 CDD:295369 35/152 (23%)
WD40 repeat 513..555 CDD:293791 8/47 (17%)
WD40 repeat 560..596 CDD:293791 10/35 (29%)
WD40 <1395..>1469 CDD:225201
WD40 <1399..1495 CDD:295369
WD40 repeat 1439..1466 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442328
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.