DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3436 and NWD1

DIOPT Version :9

Sequence 1:NP_001285543.1 Gene:CG3436 / 33180 FlyBaseID:FBgn0031229 Length:347 Species:Drosophila melanogaster
Sequence 2:XP_011526231.1 Gene:NWD1 / 284434 HGNCID:27619 Length:1564 Species:Homo sapiens


Alignment Length:390 Identity:86/390 - (22%)
Similarity:151/390 - (38%) Gaps:89/390 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 NNSVILAQEAKRSKNDLM----------AYTNRDKALLESGVRRTSNL---------QAPIMQLE 52
            |.|:.|..    ||.|.:          ...:.|::||.:|..|:..:         :...|.||
Human  1066 NGSISLVS----SKGDRLLEKLPDAVRFLVVSEDESLLAAGFGRSVRIFLADSRGFRRFMAMDLE 1126

  Fly    53 GHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYED------CENV---MAMSGHSGAVMEAHFTP 108
             ||..:.||.|..|..|:::...|..|.:|.:.|.      .|.|   :::....||:: |..:|
Human  1127 -HEDMVETAVFGTENNLIITGSLDALIQVWSLSEQGTLLDILEGVGAPVSLLARGGALV-ASASP 1189

  Fly   109 DGSHIFTCSTDKTLAFWDIATGQRQRRFKGHGNFVNSVQGSRRGQQLLC-SGS--------DDRT 164
            ..|         :...||::...|.|        |.:....|.|...:. :||        |...
Human  1190 QSS---------SFKVWDLSDAHRSR--------VPAPFLDRTGLTAVSHNGSYVYFPKIGDKNK 1237

  Fly   165 IKIWDARKKHAAHTLESPFQVTAVCFGDTGEQVISGGIDNEVKIWDI--RKQAVLHHLRGHSDTI 227
            :.|||..:.....:|::..::..:...:..:.:.:|.:...|.::.:  |:..:..........|
Human  1238 VTIWDLAEGEEQDSLDTSSEIRCLEVAEQRKLLFTGLVSGVVLVFPLNSRQDVICIPPPEARKAI 1302

  Fly   228 TGMSLSPEGDFILTNAMDNTLRVWDVRPYAPGERCVKVFQGHQHNFEKNL------------LRC 280
            ..||||...| .|..|.||.:.|.|:   ..|:.| .|..|.::.|...|            .|.
Human  1303 NCMSLSKCED-RLAIAYDNIVLVLDI---TSGDPC-PVIDGPRYTFYTQLPETLSSVAILTDYRV 1362

  Fly   281 AWSPGSDKITSGSADRHVYIWDVNTRRILYKLPGHNGSVNAVDFSPKEPLILSGSSDKTLYLGEI 345
            .:|     :|:|.    :::::..|.: .:.|..|...|..|:.|.||.|::|||.|..|.|.::
Human  1363 VYS-----MTNGD----LFLYECATSK-AFPLETHRSRVACVEVSHKEQLVVSGSEDALLCLWDL 1417

  Fly   346  345
            Human  1418  1417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3436NP_001285543.1 WD40 <19..346 CDD:225201 83/378 (22%)
WD40 50..342 CDD:238121 73/323 (23%)
WD40 repeat 58..96 CDD:293791 11/46 (24%)
WD40 repeat 102..138 CDD:293791 7/35 (20%)
WD40 repeat 143..180 CDD:293791 9/45 (20%)
WD40 repeat 186..221 CDD:293791 3/36 (8%)
WD40 repeat 227..267 CDD:293791 15/39 (38%)
WD40 repeat 277..313 CDD:293791 6/47 (13%)
WD40 repeat 319..342 CDD:293791 11/22 (50%)
NWD1XP_011526231.1 AAA 314..>399 CDD:99707
WD40 860..1156 CDD:295369 23/94 (24%)
WD40 repeat 871..908 CDD:293791
WD40 906..1286 CDD:225201 48/242 (20%)
WD40 repeat 914..952 CDD:293791
WD40 repeat 961..996 CDD:293791
WD40 repeat 1004..1041 CDD:293791
WD40 repeat 1087..1124 CDD:293791 5/36 (14%)
WD40 1127..1461 CDD:295369 72/324 (22%)
WD40 repeat 1131..1155 CDD:293791 7/23 (30%)
WD40 repeat 1259..1297 CDD:293791 3/37 (8%)
WD40 repeat 1302..1337 CDD:293791 15/39 (38%)
WD40 repeat 1352..1383 CDD:293791 5/40 (13%)
WD40 repeat 1391..1429 CDD:293791 12/27 (44%)
WD40 repeat 1436..1462 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0265
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.