| Sequence 1: | NP_001285543.1 | Gene: | CG3436 / 33180 | FlyBaseID: | FBgn0031229 | Length: | 347 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_055946.1 | Gene: | WDR43 / 23160 | HGNCID: | 28945 | Length: | 677 | Species: | Homo sapiens |
| Alignment Length: | 239 | Identity: | 55/239 - (23%) |
|---|---|---|---|
| Similarity: | 95/239 - (39%) | Gaps: | 75/239 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 15 EAKRSKNDLMAYTNRDKALLESGVRRTSNLQAPIMQLEGHEGEIF-----TAEFHPEGELLLSSG 74
Fly 75 FDRQIYIWQVYEDCENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDKTLAFWDIATGQRQRRFKGH 139
Fly 140 GNFVNSVQGSRRGQQLLCSGSDDRTIKIWDARKKHA-AHTLESPFQVTAVCF------------- 190
Fly 191 GDTGEQVISGGI-DNEVKIWDIR-----KQAVLHHLRGHSDTIT 228 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3436 | NP_001285543.1 | WD40 | <19..346 | CDD:225201 | 54/235 (23%) |
| WD40 | 50..342 | CDD:238121 | 51/204 (25%) | ||
| WD40 repeat | 58..96 | CDD:293791 | 9/42 (21%) | ||
| WD40 repeat | 102..138 | CDD:293791 | 6/35 (17%) | ||
| WD40 repeat | 143..180 | CDD:293791 | 14/37 (38%) | ||
| WD40 repeat | 186..221 | CDD:293791 | 12/53 (23%) | ||
| WD40 repeat | 227..267 | CDD:293791 | 1/2 (50%) | ||
| WD40 repeat | 277..313 | CDD:293791 | |||
| WD40 repeat | 319..342 | CDD:293791 | |||
| WDR43 | NP_055946.1 | WD 1 | 11..51 | ||
| WD40 | 19..272 | CDD:295369 | 55/239 (23%) | ||
| WD40 | <19..217 | CDD:225201 | 40/181 (22%) | ||
| WD40 repeat | 19..57 | CDD:293791 | |||
| WD 2 | 57..119 | 9/55 (16%) | |||
| WD40 repeat | 63..124 | CDD:293791 | 11/63 (17%) | ||
| WD 3 | 124..163 | 12/60 (20%) | |||
| WD40 repeat | 129..165 | CDD:293791 | 10/57 (18%) | ||
| WD 4 | 166..205 | 15/41 (37%) | |||
| WD40 repeat | 172..205 | CDD:293791 | 13/35 (37%) | ||
| WD 5 | 207..259 | 10/51 (20%) | |||
| WD40 repeat | 211..262 | CDD:293791 | 12/50 (24%) | ||
| WD 6 | 267..309 | 1/1 (100%) | |||
| WD40 repeat | 271..320 | CDD:293791 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 414..445 | ||||
| Utp12 | 474..570 | CDD:281932 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 582..677 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||