DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-15 and Ndufs5

DIOPT Version :9

Sequence 1:NP_001162841.1 Gene:ND-15 / 33179 FlyBaseID:FBgn0031228 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001025445.1 Gene:Ndufs5 / 595136 MGIID:1890889 Length:106 Species:Mus musculus


Alignment Length:71 Identity:22/71 - (30%)
Similarity:35/71 - (49%) Gaps:6/71 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KCGKFEMKMMECFEAYGLERGKRECADLISDFQECVGMQKQLMRFHAMRNERYKQWLKGERKGQE 90
            :|..||.:.:||....|..|.|:||.....||:||:...|.:.|.|.::.:|.|...:|:     
Mouse    32 RCHAFEKEWIECAHGIGGTRAKKECKIEFDDFEECLLRYKTMRRMHDIKKQREKLMKEGK----- 91

  Fly    91 FFADPP 96
             :..||
Mouse    92 -YTPPP 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-15NP_001162841.1 Ndufs5 <21..79 CDD:370878 18/52 (35%)
Ndufs5NP_001025445.1 Ndufs5 2..96 CDD:370878 20/69 (29%)
Cx9C motif 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 33..43 3/9 (33%)
Cx9C motif 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 56..66 3/9 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..106 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4110
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I5490
Isobase 1 0.950 - 0 Normalized mean entropy S5980
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109239
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16970
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.700

Return to query results.
Submit another query.