DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-15 and ndufs5

DIOPT Version :9

Sequence 1:NP_001162841.1 Gene:ND-15 / 33179 FlyBaseID:FBgn0031228 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001018469.1 Gene:ndufs5 / 553660 ZFINID:ZDB-GENE-050522-437 Length:106 Species:Danio rerio


Alignment Length:70 Identity:20/70 - (28%)
Similarity:30/70 - (42%) Gaps:6/70 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 CGKFEMKMMECFEAYGLERGKRECADLISDFQECVGMQKQLMRFHAMRNERYKQWLKGERKGQEF 91
            |..||.:.:||..|.|..|..:||.....||.||:...|.:.|...:..::.|...:|.      
Zfish    33 CHAFEKEWIECSHAIGKTRASKECNIEWEDFYECMHRFKTMKRLKEISTQKEKMIKEGT------ 91

  Fly    92 FADPP 96
            :..||
Zfish    92 YTPPP 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-15NP_001162841.1 Ndufs5 <21..79 CDD:370878 16/51 (31%)
ndufs5NP_001018469.1 Ndufs5 1..96 CDD:287207 18/68 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4110
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1549192at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109239
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16970
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.