DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-15 and ndufs5

DIOPT Version :10

Sequence 1:NP_722612.1 Gene:ND-15 / 33179 FlyBaseID:FBgn0031228 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001018469.1 Gene:ndufs5 / 553660 ZFINID:ZDB-GENE-050522-437 Length:106 Species:Danio rerio


Alignment Length:70 Identity:20/70 - (28%)
Similarity:30/70 - (42%) Gaps:6/70 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 CGKFEMKMMECFEAYGLERGKRECADLISDFQECVGMQKQLMRFHAMRNERYKQWLKGERKGQEF 91
            |..||.:.:||..|.|..|..:||.....||.||:...|.:.|...:..::.|...:|.      
Zfish    33 CHAFEKEWIECSHAIGKTRASKECNIEWEDFYECMHRFKTMKRLKEISTQKEKMIKEGT------ 91

  Fly    92 FADPP 96
            :..||
Zfish    92 YTPPP 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-15NP_722612.1 NDUFS5-like <21..79 CDD:472051 16/51 (31%)
ndufs5NP_001018469.1 Ndufs5 1..96 CDD:431131 18/68 (26%)

Return to query results.
Submit another query.