DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-15 and ndufs5

DIOPT Version :9

Sequence 1:NP_001162841.1 Gene:ND-15 / 33179 FlyBaseID:FBgn0031228 Length:101 Species:Drosophila melanogaster
Sequence 2:XP_012812490.1 Gene:ndufs5 / 549928 XenbaseID:XB-GENE-946984 Length:134 Species:Xenopus tropicalis


Alignment Length:78 Identity:23/78 - (29%)
Similarity:36/78 - (46%) Gaps:3/78 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NHQTY---DKCGKFEMKMMECFEAYGLERGKRECADLISDFQECVGMQKQLMRFHAMRNERYKQW 81
            :.|.|   ..|..||.:.:||....|..|.::||.....||.||:...|...|..|::.::.|..
 Frog    53 SQQPYRWVSSCQAFEKEWVECSHGIGQIRARKECRLEYEDFYECMSRNKLRQRLQAIQEQKKKLE 117

  Fly    82 LKGERKGQEFFAD 94
            .:|:.|..:|..|
 Frog   118 KEGKYKAPDFSKD 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-15NP_001162841.1 Ndufs5 <21..79 CDD:370878 18/60 (30%)
ndufs5XP_012812490.1 Ndufs5 32..125 CDD:370878 21/71 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1549192at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16970
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.