DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-15 and NDUFS5

DIOPT Version :9

Sequence 1:NP_001162841.1 Gene:ND-15 / 33179 FlyBaseID:FBgn0031228 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001171908.1 Gene:NDUFS5 / 4725 HGNCID:7712 Length:106 Species:Homo sapiens


Alignment Length:71 Identity:22/71 - (30%)
Similarity:34/71 - (47%) Gaps:6/71 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KCGKFEMKMMECFEAYGLERGKRECADLISDFQECVGMQKQLMRFHAMRNERYKQWLKGERKGQE 90
            :|..||.:.:||....|..|.::||.....||.||:..||.:.|...:|.:|.|...:|:     
Human    32 RCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGK----- 91

  Fly    91 FFADPP 96
             :..||
Human    92 -YTPPP 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-15NP_001162841.1 Ndufs5 <21..79 CDD:370878 18/52 (35%)
NDUFS5NP_001171908.1 Ndufs5 1..96 CDD:287207 20/69 (29%)
Cx9C motif 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 33..43 3/9 (33%)
Cx9C motif 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 56..66 3/9 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..106 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4110
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5980
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1549192at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109239
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16970
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.660

Return to query results.
Submit another query.