DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-15 and Ndufs5

DIOPT Version :9

Sequence 1:NP_001162841.1 Gene:ND-15 / 33179 FlyBaseID:FBgn0031228 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_001025223.1 Gene:Ndufs5 / 362588 RGDID:1311081 Length:106 Species:Rattus norvegicus


Alignment Length:71 Identity:22/71 - (30%)
Similarity:34/71 - (47%) Gaps:6/71 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KCGKFEMKMMECFEAYGLERGKRECADLISDFQECVGMQKQLMRFHAMRNERYKQWLKGERKGQE 90
            :|..||.:.:||....|..|.|:||.....||:||....|.:.|.|.::.:|.|...:|:     
  Rat    32 RCHAFEKEWIECAHGIGATRAKKECKIEYEDFEECFLRFKTIRRMHEIKKQREKLMKEGK----- 91

  Fly    91 FFADPP 96
             :..||
  Rat    92 -YTPPP 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-15NP_001162841.1 Ndufs5 <21..79 CDD:370878 18/52 (35%)
Ndufs5NP_001025223.1 Ndufs5 2..96 CDD:370878 20/69 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4110
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I5399
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1549192at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109239
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.730

Return to query results.
Submit another query.