powered by:
Protein Alignment ND-15 and Ndufs5
DIOPT Version :9
Sequence 1: | NP_001162841.1 |
Gene: | ND-15 / 33179 |
FlyBaseID: | FBgn0031228 |
Length: | 101 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001025223.1 |
Gene: | Ndufs5 / 362588 |
RGDID: | 1311081 |
Length: | 106 |
Species: | Rattus norvegicus |
Alignment Length: | 71 |
Identity: | 22/71 - (30%) |
Similarity: | 34/71 - (47%) |
Gaps: | 6/71 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 KCGKFEMKMMECFEAYGLERGKRECADLISDFQECVGMQKQLMRFHAMRNERYKQWLKGERKGQE 90
:|..||.:.:||....|..|.|:||.....||:||....|.:.|.|.::.:|.|...:|:
Rat 32 RCHAFEKEWIECAHGIGATRAKKECKIEYEDFEECFLRFKTIRRMHEIKKQREKLMKEGK----- 91
Fly 91 FFADPP 96
:..||
Rat 92 -YTPPP 96
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4110 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
45 |
1.000 |
Inparanoid score |
I5399 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1549192at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_109239 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
7 | 6.730 |
|
Return to query results.
Submit another query.