DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42399 and AT3G18530

DIOPT Version :9

Sequence 1:NP_608498.3 Gene:CG42399 / 33176 FlyBaseID:FBgn0259818 Length:1655 Species:Drosophila melanogaster
Sequence 2:NP_188483.4 Gene:AT3G18530 / 821384 AraportID:AT3G18530 Length:361 Species:Arabidopsis thaliana


Alignment Length:234 Identity:55/234 - (23%)
Similarity:103/234 - (44%) Gaps:40/234 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1402 AQRRISPSKQPI--KMS-QAE-LFPQNMVRFD----------RPR-EALLKTFDQLDSSNWEVNV 1451
            ::|.|...|.|.  ||: :|| ..|||.|..|          :|. |.::...:.:.|.:.. ||
plant    15 SERNIDCKKNPCAGKMNGKAEDRPPQNSVPLDHNHPTGDEIEKPEAERVIVELEYIKSKDLN-NV 78

  Fly  1452 SG----LKSMVRLIRYH-------AETLD--NQMHM----------TCIQLTRSVRNLRSQVARA 1493
            :.    ||..:.|..|:       :.:||  :..|.          ..:.:.:|::|.||.|::.
plant    79 AEVDAVLKVSIVLSWYYTMLYCDFSFSLDRSSSFHFPQGRNAAFAKVILFVVKSLKNPRSAVSKT 143

  Fly  1494 SCQAAAELFSLKSTSLQQECDDLVCALLHRTADTNRFLRADANRALESMVDHAQPQKILNILATK 1558
            :|..:.::||..:..:..:.|.|:..||.:::...||:...|.|||.:|..|..|..:|..| ..
plant   144 ACMTSEDIFSSYNDHIFDQLDRLLTQLLLKSSQDKRFVCEAAERALVAMTTHVSPALLLPKL-RP 207

  Fly  1559 GAQHQNALVRTTSAKLLFRLVERLGSDRIYAMGRESRDK 1597
            ..::::..:|..::......|.|||.:.:...|.|:..:
plant   208 CLKNKSPRIRAKASACFSGCVPRLGIEGMREYGIETNSQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42399NP_608498.3 CLASP_N 1433..1627 CDD:289144 41/188 (22%)
AT3G18530NP_188483.4 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2933
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.