DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and NAM8

DIOPT Version :10

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_011954.1 Gene:NAM8 / 856486 SGDID:S000001128 Length:523 Species:Saccharomyces cerevisiae


Alignment Length:189 Identity:47/189 - (24%)
Similarity:69/189 - (36%) Gaps:43/189 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QQMYSG-----ASVMTISETNIDGYRYGIPSGQ---------------HQEQPIYPFLPNENGDQ 52
            ||..||     .|..:::..|:|. |: :..||               |..|.|||.        
Yeast   244 QQHVSGNNDYNRSSSSLNNENVDS-RF-LSKGQSFLSNGNNNMGFKRNHMSQFIYPV-------- 298

  Fly    53 LVGQLEDDDDEEEDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDNNGRPRNFGFVTY 117
               |.:...:...|....|:|.|.|...|||:.|...|...|.|..|:||..     :..|||.|
Yeast   299 ---QQQPSLNHFTDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKIPVG-----KCCGFVQY 355

  Fly   118 QRLCAVPFALDLYQGLELFQKKVTIK-QQGGKQLPAYNQSRLRNQFMME----ALPQPS 171
            ....:...|:...||..:...:|.:. .:..||.....|:.|.|...::    .|.||:
Yeast   356 VDRLSAEAAIAGMQGFPIANSRVRLSWGRSAKQTALLQQAMLSNSLQVQQQQPGLQQPN 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:409773 22/73 (30%)
NAM8NP_011954.1 RRM1_NGR1_NAM8_like 55..144 CDD:410023
RRM2_SECp43_like 162..241 CDD:409781
RRM3_NGR1_NAM8_like 312..383 CDD:409782 22/75 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.