DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and RBP47A

DIOPT Version :10

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001321909.1 Gene:RBP47A / 841384 AraportID:AT1G49600 Length:450 Species:Arabidopsis thaliana


Alignment Length:140 Identity:32/140 - (22%)
Similarity:49/140 - (35%) Gaps:30/140 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 ENGDQLV---------GQLEDDDDEEEDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPT 103
            :||.|.:         |.:.|.:....     |:|.|.||..||||.|.:.|...|.:..|:||.
plant   301 QNGSQALTLAGGHGGNGSMSDGESNNS-----TIFVGGLDADVTEEDLMQPFSDFGEVVSVKIPV 360

  Fly   104 DNNGRPRNFGFVTYQRLCAVPFALDLYQGLELFQKKVTIKQQGGKQLPAYNQSRLRNQFMMEALP 168
            .     :..|||.:....:...|:....|..:           ||.....:..|..|:.:.|...
plant   361 G-----KGCGFVQFANRQSAEEAIGNLNGTVI-----------GKNTVRLSWGRSPNKQVQENFS 409

  Fly   169 QPSPLRHARH 178
            .....:|..|
plant   410 WICVFKHYMH 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:409773 20/73 (27%)
RBP47ANP_001321909.1 RRM1_SECp43_like 120..200 CDD:409780
RRM2_SECp43_like 212..291 CDD:409781
RRM_SF 326..397 CDD:473069 22/91 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.