DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and RBP45A

DIOPT Version :10

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_568815.1 Gene:RBP45A / 835581 AraportID:AT5G54900 Length:387 Species:Arabidopsis thaliana


Alignment Length:119 Identity:29/119 - (24%)
Similarity:45/119 - (37%) Gaps:23/119 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PSGQHQEQPIYPFLPNENGDQLVGQLEDDDDEEEDEEQRTLFCGNLDERVTEEILYEVFLQAGPI 96
            |:......|:.|.:.........|        :.|....|:|.|.||..||::.|..:|.|.|.:
plant   230 PAANKNALPMQPAMYQNTQGANAG--------DNDPNNTTIFVGGLDANVTDDELKSIFGQFGEL 286

  Fly    97 EGVRIPTDNNGRPRNFGFVTYQRLCAVPFALDLYQGLELFQKKVTIKQQGGKQL 150
            ..|:||..     :..|||.|....:...||.:..|.:|          ||:.:
plant   287 LHVKIPPG-----KRCGFVQYANKASAEHALSVLNGTQL----------GGQSI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:409773 22/73 (30%)
RBP45ANP_568815.1 RRM1_SECp43_like 61..138 CDD:409780
RRM2_SECp43_like 153..232 CDD:409781 1/1 (100%)
RRM3_NGR1_NAM8_like 259..330 CDD:409782 24/82 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.