DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and AT5G19350

DIOPT Version :10

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_197436.1 Gene:AT5G19350 / 832055 AraportID:AT5G19350 Length:425 Species:Arabidopsis thaliana


Alignment Length:78 Identity:23/78 - (29%)
Similarity:38/78 - (48%) Gaps:1/78 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 EEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDN-NGRPRNFGFVTYQRLCAVPFALDLY 130
            ||.|||:.|:|...|.|..|...|.|.|.:..|::..:. .|:|..:||:.:....|....|..|
plant    21 EEVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAERTLQTY 85

  Fly   131 QGLELFQKKVTIK 143
            .|.::...::|.:
plant    86 NGTQMPGTELTFR 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:409773 21/74 (28%)
AT5G19350NP_197436.1 RRM1_SECp43_like 25..105 CDD:409780 20/74 (27%)
RRM2_SECp43_like 115..194 CDD:409781
RRM_SF 237..306 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.