DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and PSRP2

DIOPT Version :10

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_566958.3 Gene:PSRP2 / 824379 AraportID:AT3G52150 Length:253 Species:Arabidopsis thaliana


Alignment Length:55 Identity:19/55 - (34%)
Similarity:30/55 - (54%) Gaps:1/55 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 EEEDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDN-NGRPRNFGFVT 116
            :...|..|.::.||:...||.|.|.::..:.|.:|.|::..|. :||.|.|||.|
plant    69 DPSSEAARRVYIGNIPRTVTNEQLTKLVEEHGAVEKVQVMYDKYSGRSRRFGFAT 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:409773 18/49 (37%)
PSRP2NP_566958.3 RRM1_PSRP2_like 77..156 CDD:410188 17/47 (36%)
RRM2_PSRP2 175..253 CDD:410189
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.