DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and AT2G37220

DIOPT Version :10

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_181259.1 Gene:AT2G37220 / 818299 AraportID:AT2G37220 Length:289 Species:Arabidopsis thaliana


Alignment Length:157 Identity:39/157 - (24%)
Similarity:57/157 - (36%) Gaps:31/157 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MYSGASVMTISETNIDGYRYGI--PSGQHQEQPIYPFLPNENGDQ-------------------L 53
            |.:.||.:.:|..|.....:|:  |:......|...|..|.:...                   :
plant     1 MAASASSLALSSFNPKSLPFGVSRPASVSLLSPSLSFKLNSDSVSFSIAAKWNSPASRFARNVAI 65

  Fly    54 VGQLEDDDD---------EEEDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDN-NGR 108
            ..:.|.::|         |:.......||.|||...|....|.::|..||.:|.|.:..|. .||
plant    66 TSEFEVEEDGFADVAPPKEQSFSADLKLFVGNLPFNVDSAQLAQLFESAGNVEMVEVIYDKITGR 130

  Fly   109 PRNFGFVTYQRLCAVPFALDLYQGLEL 135
            .|.|||||...:..|..|...:.|.||
plant   131 SRGFGFVTMSSVSEVEAAAQQFNGYEL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:409773 26/68 (38%)
AT2G37220NP_181259.1 RRM_SF 92..170 CDD:473069 26/66 (39%)
RRM 204..287 CDD:440488
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.