DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and Rbm7

DIOPT Version :9

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_659197.2 Gene:Rbm7 / 67010 MGIID:1914260 Length:265 Species:Mus musculus


Alignment Length:218 Identity:60/218 - (27%)
Similarity:94/218 - (43%) Gaps:52/218 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 EEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDNNGRPRNFGFVTYQRLCAVPFALDLYQ 131
            |..||||.|||:.:||||:|:|:|.||||:..|:||.|.:|:.:.|.||.::...:||:|::|..
Mouse     7 EADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKLKQFAFVNFKHEVSVPYAMNLLN 71

  Fly   132 GLELFQKKVTIKQQGGKQ------LPAYNQSRLRNQFMMEALPQ--------------------P 170
            |::||.:.:.|:.:.|..      ..:|.|..:.|.......|.                    .
Mouse    72 GIKLFGRPIKIQFRSGSSHASQDASVSYPQHHVGNLSPTSTSPNSYERTVGNVSPTAQMVQRSFS 136

  Fly   171 SPLRHARHSLHN------------GKPY--------DRNPFGHNADQ------RRRSDSSVMERN 209
            ||..:.|.::.|            |.|:        ...|.||..:|      |:.:.||..:|.
Mouse   137 SPEDYQRQAVMNSVFRQMSYAGKFGSPHADQLGFSPSAQPHGHTFNQSSSSQWRQDALSSQRKRQ 201

  Fly   210 RLKPQQHHQHMQGGSRRSDQRSN 232
            ...|....:|.....|.||..|:
Mouse   202 NSHPYLADRHYSREQRYSDHGSD 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:240782 33/73 (45%)
RRM <70..210 CDD:223796 53/191 (28%)
Rbm7NP_659197.2 RRM <9..>101 CDD:223796 36/91 (40%)
RRM_RBM7 9..83 CDD:241036 33/73 (45%)
ZCCHC8 binding. /evidence=ECO:0000250|UniProtKB:Q9Y580 25..35 5/9 (56%)
ZCCHC8 binding. /evidence=ECO:0000250|UniProtKB:Q9Y580 59..76 5/16 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..125 4/33 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..224 13/57 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..265
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849232
Domainoid 1 1.000 73 1.000 Domainoid score I9202
eggNOG 1 0.900 - - E1_KOG4454
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D491103at33208
OrthoFinder 1 1.000 - - FOG0003483
OrthoInspector 1 1.000 - - otm43349
orthoMCL 1 0.900 - - OOG6_108583
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5568
SonicParanoid 1 1.000 - - X2850
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.640

Return to query results.
Submit another query.