DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and RBM4

DIOPT Version :10

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_002887.2 Gene:RBM4 / 5936 HGNCID:9901 Length:364 Species:Homo sapiens


Alignment Length:105 Identity:26/105 - (24%)
Similarity:38/105 - (36%) Gaps:24/105 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDNNGRPRNFGFVTYQRLCAVPFALDLYQGLELF 136
            ||.|||....||:.:..:|.|.|.:....|       .:|:|||..:...|   |.|..:.|..:
Human     4 LFIGNLPREATEQEIRSLFEQYGKVLECDI-------IKNYGFVHIEDKTA---AEDAIRNLHHY 58

  Fly   137 --------------QKKVTIKQQGGKQLPAYNQSRLRNQF 162
                          :.|.:.|...|...|......||.:|
Human    59 KLHGVNINVEASKNKSKTSTKLHVGNISPTCTNKELRAKF 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:409773 20/84 (24%)
RBM4NP_002887.2 RRM1_RBM4 2..68 CDD:410018 19/73 (26%)
RRM2_RBM4 78..144 CDD:410019 6/21 (29%)
PTZ00368 <145..>181 CDD:173561
ZnF_C2HC 161..176 CDD:197667
Interaction with TNPO3. /evidence=ECO:0000269|PubMed:12628928 196..364
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.