DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and hnrnpm

DIOPT Version :10

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001243560.1 Gene:hnrnpm / 555643 ZFINID:ZDB-GENE-030131-6898 Length:686 Species:Danio rerio


Alignment Length:111 Identity:34/111 - (30%)
Similarity:51/111 - (45%) Gaps:15/111 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PFLPNE--NGDQLVGQLEDDDDEEEDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDN 105
            |.:|||  :|.| .|::..           |:|..|||.:|..:.|.|||..||.:....|..|.
Zfish   187 PNIPNEVIHGLQ-AGKIGS-----------TIFVANLDYKVGWKKLKEVFGMAGMVVRADILEDK 239

  Fly   106 NGRPRNFGFVTYQRLCAVPFALDLYQGLELFQKKVTIKQQGGKQLP 151
            :|:.|..|.||:........|:.::.|..||.:.:.:|.. .|.||
Zfish   240 DGKSRGMGTVTFDMPIEAVQAVSMFNGQLLFNRVMHVKLD-EKSLP 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:409773 23/73 (32%)
hnrnpmNP_001243560.1 RRM1_hnRNPM 49..124 CDD:410058
RRM2_hnRNPM 204..279 CDD:410060 24/85 (28%)
RRM3_hnRNPM 610..686 CDD:410062
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.