Sequence 1: | NP_608497.1 | Gene: | CG11454 / 33175 | FlyBaseID: | FBgn0031224 | Length: | 238 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001016096.1 | Gene: | rbm7 / 548850 | XenbaseID: | XB-GENE-947267 | Length: | 249 | Species: | Xenopus tropicalis |
Alignment Length: | 223 | Identity: | 69/223 - (30%) |
---|---|---|---|
Similarity: | 97/223 - (43%) | Gaps: | 72/223 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 EEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDNNGRPRNFGFVTYQRLCAVPFALDLYQ 131
Fly 132 GLELFQKKVTIK-QQGGKQLPAYNQSRLRNQFMMEALPQPSPLRHARHSLH------------NG 183
Fly 184 KPYDRN------PFGHNADQR-RRSDSS-------------------------VMERNRLKP--- 213
Fly 214 ----QQHHQHMQGGSRRSDQRSNNKRRL 237 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11454 | NP_608497.1 | RRM_RBM7_like | 69..143 | CDD:240782 | 35/73 (48%) |
RRM | <70..210 | CDD:223796 | 58/184 (32%) | ||
rbm7 | NP_001016096.1 | SF-CC1 | <3..>155 | CDD:273721 | 59/169 (35%) |
RRM_RBM7 | 7..81 | CDD:241036 | 35/73 (48%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1298240at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5568 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.040 |