DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and rbm7

DIOPT Version :9

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001016096.1 Gene:rbm7 / 548850 XenbaseID:XB-GENE-947267 Length:249 Species:Xenopus tropicalis


Alignment Length:223 Identity:69/223 - (30%)
Similarity:97/223 - (43%) Gaps:72/223 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 EEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDNNGRPRNFGFVTYQRLCAVPFALDLYQ 131
            |..||||.||||.|.|||:|:|:||||||...|:||.|.:|:|:.|.||.::...:||:.:.|..
 Frog     5 EADRTLFVGNLDPRATEELLFELFLQAGPAISVKIPKDKDGKPKQFAFVNFKHEESVPYGMSLLN 69

  Fly   132 GLELFQKKVTIK-QQGGKQLPAYNQSRLRNQFMMEALPQPSPLRHARHSLH------------NG 183
            |::||.:.:.|: :.|.|.:|....:              ||     ||:|            ||
 Frog    70 GIKLFGRPLKIQYRSGSKHIPQDGNN--------------SP-----HSIHTNGNGSPTGASPNG 115

  Fly   184 KPYDRN------PFGHNADQR-RRSDSS-------------------------VMERNRLKP--- 213
            ..||||      | ||:..|. :||.||                         ...::...|   
 Frog   116 SRYDRNGDYIKSP-GHSPVQNLQRSFSSPDNLQRQAVINSFMWQQSQYGTGSQAQSQSSFSPPSS 179

  Fly   214 ----QQHHQHMQGGSRRSDQRSNNKRRL 237
                .|:.|..|..|||.|..:..|.|:
 Frog   180 QMYYNQYSQSSQQPSRRYDSSAQRKDRV 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:240782 35/73 (48%)
RRM <70..210 CDD:223796 58/184 (32%)
rbm7NP_001016096.1 SF-CC1 <3..>155 CDD:273721 59/169 (35%)
RRM_RBM7 7..81 CDD:241036 35/73 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1298240at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5568
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.