DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and RBM11

DIOPT Version :9

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001307531.1 Gene:RBM11 / 54033 HGNCID:9897 Length:288 Species:Homo sapiens


Alignment Length:274 Identity:63/274 - (22%)
Similarity:101/274 - (36%) Gaps:110/274 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDNNGRPRNFGFVTYQRLCAVPFALDL 129
            ::|..||:|.|||:.||.||||||:||||||:..|.|..|..|:|::||||.::...:|.:|:.|
Human     5 QEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTICKDREGKPKSFGFVCFKHPESVSYAIAL 69

  Fly   130 YQGLELFQKKVTIKQQGGK---------------------------------------------- 148
            ..|:.|:.:.:.::.:.|.                                              
Human    70 LNGIRLYGRPINVQYRFGSSRSSEPANQSFESCVKINSHNYRNEEMLVGRSSFPMQYFPINNTSL 134

  Fly   149 --------------------------QLPAYN-----------QSRLRNQFMMEALP-------- 168
                                      |||.|.           .|.|.:...:||.|        
Human   135 PQEYFLFQKMMNVLFSQQWHVYNPVLQLPYYEMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQ 199

  Fly   169 QPS---------PLRHA---RHSLHNGKPYDRNPFGHNADQRRRSDSSVMERNRLKPQQHHQHMQ 221
            |||         ||.::   ..||::....:..|..:....::.|||.:.:.|:.|.|:.     
Human   200 QPSDSDLYQMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQQPSDSDLYQMNKRKRQKQ----- 259

  Fly   222 GGSRRSDQRSNNKR 235
              :..||..::|.|
Human   260 --TSDSDSSTDNNR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:240782 34/73 (47%)
RRM <70..210 CDD:223796 55/242 (23%)
RBM11NP_001307531.1 RRM <5..139 CDD:223796 36/133 (27%)
RRM_RBM11 9..83 CDD:241037 34/73 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158851
Domainoid 1 1.000 76 1.000 Domainoid score I8975
eggNOG 1 0.900 - - E1_KOG4454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1298240at2759
OrthoFinder 1 1.000 - - FOG0003483
OrthoInspector 1 1.000 - - otm41293
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5568
SonicParanoid 1 1.000 - - X2850
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.740

Return to query results.
Submit another query.