DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and Ref1

DIOPT Version :10

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_651968.1 Gene:Ref1 / 44029 FlyBaseID:FBgn0010774 Length:266 Species:Drosophila melanogaster


Alignment Length:72 Identity:22/72 - (30%)
Similarity:35/72 - (48%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 LFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDNNGRPRNFGFVTYQRLCAVPFALDLYQGLELF 136
            |..||||..|:...:.|:|...|||:...:..|.:||......|.::|......|:..|.|:.|.
  Fly   111 LIVGNLDYGVSNTDIKELFNDFGPIKKAAVHYDRSGRSLGTADVIFERRADALKAIKQYHGVPLD 175

  Fly   137 QKKVTIK 143
            .:.:||:
  Fly   176 GRPMTIQ 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:409773 21/70 (30%)
Ref1NP_651968.1 sex-lethal 31..>184 CDD:273740 22/72 (31%)
RRM_THOC4 109..183 CDD:410081 22/72 (31%)
FoP_duplication 202..>260 CDD:464005
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.