DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and CstF64

DIOPT Version :10

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_477453.1 Gene:CstF64 / 42239 FlyBaseID:FBgn0027841 Length:419 Species:Drosophila melanogaster


Alignment Length:166 Identity:40/166 - (24%)
Similarity:70/166 - (42%) Gaps:28/166 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 DDDEEE---DEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTD-NNGRPRNFGFVTYQRL 120
            |..:|:   |:..|::|.||:....|||.|.|:|.:.||:..:::..| .:|:|:.|||..|:..
  Fly     3 DKAQEQSIMDKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQ 67

  Fly   121 CAVPFALDLYQGLELFQKKVTIKQQGGKQLPAYNQSRLRNQFMMEALPQPSPLRHARHSLHNGKP 185
            .....|:....|.|:          ||:.|...|....:::..|:.|.|              .|
  Fly    68 ETALSAMRNLNGYEI----------GGRTLRVDNACTEKSRMEMQQLLQ--------------GP 108

  Fly   186 YDRNPFGHNADQRRRSDSSVMERNRLKPQQHHQHMQ 221
            ...||:|...:.....:........|.|:|.::.|:
  Fly   109 QVENPYGEPCEPEDAPELITKTVASLPPEQMYELMK 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:409773 22/74 (30%)
CstF64NP_477453.1 RRM_CSTF2_CSTF2T 10..94 CDD:410072 27/93 (29%)
CSTF2_hinge 111..190 CDD:433869 7/34 (21%)
CSTF_C 377..416 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.