DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and rbm7

DIOPT Version :9

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_956219.1 Gene:rbm7 / 334784 ZFINID:ZDB-GENE-030131-6724 Length:252 Species:Danio rerio


Alignment Length:248 Identity:72/248 - (29%)
Similarity:106/248 - (42%) Gaps:86/248 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 DEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDNNGRPRNFGFVTYQRLCAVPFALDLY 130
            ||..||||.||||.:||||:::|:||||||:..|:||.:|.|:.:.|.||.::...:||:||:|.
Zfish     5 DEADRTLFVGNLDPQVTEEVIFELFLQAGPLIKVKIPKNNEGKSKLFAFVNFKHEVSVPYALNLL 69

  Fly   131 QGLELFQKKVTIK----------------------------QQGGK----------------QLP 151
            .|:.|..:::.||                            .:||:                |.|
Zfish    70 NGIRLHGRQLNIKFKTGSSHINQEGKSPANSQNPSPANTPGHRGGRTPEQMGSPSYSPPQHMQRP 134

  Fly   152 AYNQSRLRNQFMM-------------------EALPQP--------SPLRHARHSLHNGKPYDRN 189
            ..:...|:.|.||                   :.:.||        |..|..|||     |.|.|
Zfish   135 FSSPDTLQRQAMMNNMWQVQMQQLQMLSGTFQQGMQQPRGNADGGWSGHRGQRHS-----PQDNN 194

  Fly   190 PFGHNA-DQRRRSDSSVMERNRLKPQQ----HHQHMQGGSRRS---DQRSNNK 234
              .|.. |||..:.::..||||...|:    ||....||..|:   |:|.:::
Zfish   195 --NHQGRDQRHGNGANNYERNRRDGQRGDFYHHDDRSGGHNRNYPPDRRRDSR 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:240782 34/73 (47%)
RRM <70..210 CDD:223796 60/211 (28%)
rbm7NP_956219.1 RRM <8..150 CDD:223796 44/141 (31%)
RRM_SF 8..82 CDD:302621 34/73 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..137 4/48 (8%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..252 26/82 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594806
Domainoid 1 1.000 75 1.000 Domainoid score I9052
eggNOG 1 0.900 - - E1_KOG4454
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1298240at2759
OrthoFinder 1 1.000 - - FOG0003483
OrthoInspector 1 1.000 - - oto39220
orthoMCL 1 0.900 - - OOG6_108583
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5568
SonicParanoid 1 1.000 - - X2850
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.640

Return to query results.
Submit another query.