DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and Rbm7

DIOPT Version :9

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:XP_038937367.1 Gene:Rbm7 / 315634 RGDID:1308017 Length:265 Species:Rattus norvegicus


Alignment Length:218 Identity:60/218 - (27%)
Similarity:96/218 - (44%) Gaps:52/218 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 EEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDNNGRPRNFGFVTYQRLCAVPFALDLYQ 131
            |..||||.|||:.:||||:|:|:|.||||:..|:||.|.:|:.:.|.||.::...:||:|::|..
  Rat     7 EADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKLKQFAFVNFKHEVSVPYAMNLLN 71

  Fly   132 GLELFQKKVTIKQQGGKQ------LPAYNQSRLRNQFMMEALPQ--------------------P 170
            |::||.:.:.|:.:.|..      ..:|.|..:.|.......|.                    .
  Rat    72 GIKLFGRPIKIQFRSGSSHLSQDASTSYPQHHMGNLSPTSTSPNSYERTVGNVTPPAQMVQRSFS 136

  Fly   171 SPLRHARHSLHN------------GKPY-DR-------NPFGHNADQ------RRRSDSSVMERN 209
            :|..:.|.::.|            |.|: |:       .|.||..:|      |:.:.||..:|.
  Rat   137 TPEDYQRQAVMNSVFRQMSYVGKFGSPHADQLGFSPSVQPHGHTFNQSSSSQWRQDAVSSQRKRQ 201

  Fly   210 RLKPQQHHQHMQGGSRRSDQRSN 232
            ...|....:|.....|.||..|:
  Rat   202 NSHPYLADRHYSREQRYSDHGSD 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:240782 33/73 (45%)
RRM <70..210 CDD:223796 53/191 (28%)
Rbm7XP_038937367.1 RRM_RBM7 9..83 CDD:410005 33/73 (45%)
PABP-1234 <12..203 CDD:130689 51/190 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352852
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4454
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1298240at2759
OrthoFinder 1 1.000 - - FOG0003483
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108583
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2850
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.610

Return to query results.
Submit another query.