DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11454 and Rbm11

DIOPT Version :9

Sequence 1:NP_608497.1 Gene:CG11454 / 33175 FlyBaseID:FBgn0031224 Length:238 Species:Drosophila melanogaster
Sequence 2:XP_006248056.1 Gene:Rbm11 / 288321 RGDID:1305195 Length:238 Species:Rattus norvegicus


Alignment Length:229 Identity:61/229 - (26%)
Similarity:98/229 - (42%) Gaps:70/229 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 EDEEQRTLFCGNLDERVTEEILYEVFLQAGPIEGVRIPTDNNGRPRNFGFVTYQRLCAVPFALDL 129
            ::|..||:|.|||:.||.||||||:||||||:..|.:..|.:|:|::||||.::...:|.:|:.|
  Rat     5 QEEADRTVFVGNLEARVREEILYELFLQAGPLTKVTLCKDRDGKPKSFGFVCFKHPESVSYAIAL 69

  Fly   130 YQGLELFQKKVTIKQQGGKQL---PAYNQS----------RLRNQFMM--------------EAL 167
            ..|:.|:.:.:.::.:.|...   || |||          ..||..|:              .||
  Rat    70 LNGIRLYGRPINVQYRFGSSRSSEPA-NQSFESCAKINSHSFRNDEMVCRPSFPVPFFPITSAAL 133

  Fly   168 PQ----------------------------PSPLRHARHSLHNGKPYDRNPFGHNADQRRRSDSS 204
            ||                            |:|...: .||::....:..|..:....:..:|..
  Rat   134 PQEYFFFQKMQWYTHSPALQPPFYEMTAPLPNPASDS-CSLNHAPDLEAGPSSYEWTHQPPNDPD 197

  Fly   205 V---MERNRLKPQQHHQHMQGGSRRSDQRSNNKR 235
            :   ::|.|.:|...          ||..|.:||
  Rat   198 LYPRIKRKRQRPDSD----------SDSSSGDKR 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11454NP_608497.1 RRM_RBM7_like 69..143 CDD:240782 33/73 (45%)
RRM <70..210 CDD:223796 53/197 (27%)
Rbm11XP_006248056.1 RRM_RBM11 9..83 CDD:410006 33/73 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352851
Domainoid 1 1.000 69 1.000 Domainoid score I9433
eggNOG 1 0.900 - - E1_KOG4454
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1298240at2759
OrthoFinder 1 1.000 - - FOG0003483
OrthoInspector 1 1.000 - - oto97042
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2850
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.710

Return to query results.
Submit another query.